Recombinant Human Probable G-protein coupled receptor 153 (GPR153)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Evolution

The GPR153 protein is encoded by the GPR153 gene located on human chromosome 1p36.31. This gene demonstrates remarkable evolutionary conservation across multiple species, being present in chimpanzees, rhesus monkeys, dogs, cows, mice, rats, chickens, frogs, and zebrafish . This high degree of conservation suggests that GPR153 likely serves fundamental biological functions that have been maintained throughout vertebrate evolution. Phylogenetic analyses have firmly placed GPR153 within the α-group of the Rhodopsin family of G-protein coupled receptors (GPCRs) . This classification is particularly significant as the α-group is the only GPCR group containing numerous receptors for biogenic amines, which represent major targets for pharmaceutical intervention.

Evolutionary studies indicate that GPR153 shares a common ancestor with GPR162, with the two proteins likely diverging through a gene duplication event that occurred before the divergence of major vertebrate lineages . This evolutionary relationship provides important context for understanding the potential functional roles of GPR153, as related receptors often demonstrate similar mechanistic properties while evolving specialized functions.

Protein Structure and Domains

GPR153 is a full-length protein consisting of 609 amino acids with a molecular mass of 65,361 Da . As a member of the GPCR superfamily, it possesses the characteristic seven transmembrane domain structure that defines this receptor class . The complete amino acid sequence of human GPR153 has been determined and begins with MSDERRLPGS and continues through a series of hydrophobic and hydrophilic regions that form the canonical GPCR architecture .

The protein structure of GPR153 has been computationally predicted through the AlphaFold project (Structure version 2), providing insights into its three-dimensional conformation . This structural information is crucial for understanding how GPR153 might interact with potential ligands and intracellular signaling partners. The predicted structure features a single chain with no identified clinical variants as of current data .

Bacterial Expression Systems

Recombinant human GPR153 has been successfully expressed in Escherichia coli expression systems, which represent one of the most efficient and cost-effective platforms for protein production . The full-length GPR153 protein (amino acids 1-609) has been produced with an N-terminal histidine tag (His tag), facilitating purification through metal affinity chromatography . This bacterial expression system yields the protein in a form that achieves greater than 90% purity as determined by SDS-PAGE analysis .

The bacterial expression product is typically harvested in a lyophilized powder form that enhances stability during storage and shipping . When expressed in E. coli, the recombinant GPR153 protein corresponds to the UniProt entry Q6NV75, confirming its identity as the authentic human sequence . This expression system provides significant quantities of protein for structural and preliminary functional studies, though it may lack some post-translational modifications present in mammalian-expressed versions.

Mammalian Expression Systems

For applications requiring mammalian-specific post-translational modifications and proper protein folding, GPR153 has also been engineered for expression in mammalian cell systems . This typically involves the use of expression vectors such as pCMV6-AC-GFP, which places the GPR153 open reading frame (ORF) under the control of a strong CMV promoter . The ORF size for GPR153 in these constructs is approximately 1827 base pairs .

Mammalian expression systems often incorporate selection markers such as neomycin resistance to facilitate the identification and propagation of successfully transfected cells . These systems are particularly valuable for studies investigating receptor trafficking, localization, and signaling in a context that more closely resembles the native environment of GPR153.

His-Tagged GPR153

One of the most common recombinant forms of GPR153 features an N-terminal histidine tag . This His-tagged variant is typically produced in E. coli and supplied as a lyophilized powder for research applications . The addition of the His tag does not significantly alter the molecular properties of the protein but provides a convenient handle for purification and detection purposes.

The His-tagged GPR153 is stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances protein stability . For laboratory use, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol for long-term storage at -20°C or -80°C . This preparation is particularly suitable for biochemical assays, antibody production, and structural studies.

GFP-Tagged GPR153

For applications requiring visualization of the receptor in cellular contexts, a turbo GFP (tGFP)-tagged variant of GPR153 has been developed . This construct places the GFP tag at the C-terminus of the GPR153 protein, allowing for fluorescent tracking of receptor localization and trafficking within living cells . This tagged version is particularly valuable for studying the subcellular distribution of GPR153 and its dynamic responses to potential ligands or cellular signaling events.

The tGFP-tagged GPR153 is typically supplied in expression-ready plasmid form for transfection into mammalian cells . These constructs are purified using ion-exchange column chromatography and typically shipped as dried plasmid DNA that can be reconstituted with sterile water prior to experimental use .

Tissue Expression Patterns

GPR153 displays a notable expression pattern with significant presence in the central nervous system. The receptor is widely expressed throughout the brain, with particularly high levels detected in the thalamus, cerebellum, and the arcuate nucleus . This distribution pattern suggests potential roles in neurological processes, possibly involving sensory integration, motor coordination, and neuroendocrine functions.

Beyond the central nervous system, recent research has identified GPR153 expression in the anterior pituitary (AP) of heifers . Importantly, some GPR153 proteins colocalize with gonadotropin-releasing hormone receptors (GnRHR) in the plasma membrane of bovine gonadotrophs . This colocalization pattern is particularly interesting as it suggests a potential role for GPR153 in reproductive endocrinology. Furthermore, the expression levels of GPR153 in these tissues appear to be dependent on reproductive stage, indicating possible hormonal regulation of receptor abundance .

Orphan Receptor Status

Despite significant advances in GPCR research, GPR153 remains classified as an orphan receptor, meaning that its endogenous ligand has not yet been identified . This orphan status represents a significant gap in our understanding of GPR153 function, as ligand binding typically initiates the signaling cascades that mediate GPCR biological activities. The identification of the natural ligand for GPR153 would substantially advance our comprehension of its physiological roles.

The orphan status of GPR153 makes it a target of considerable interest for deorphanization campaigns that aim to identify the endogenous compounds that activate this receptor. Such efforts typically involve screening libraries of potential ligands against cells expressing recombinant GPR153 and monitoring for activation of downstream signaling pathways.

Laboratory Protocols

For research applications, recombinant GPR153 proteins require specific handling procedures to maintain activity and stability. Lyophilized powder forms of the protein should be centrifuged briefly before opening to ensure all material is collected at the bottom of the container . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is typically recommended, with the addition of glycerol (typically 5-50% final concentration) for preparations intended for long-term storage .

After reconstitution, it is advisable to aliquot the protein solution to avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity . Working aliquots can be stored at 4°C for up to one week, while longer-term storage requires freezing at -20°C or -80°C . These handling precautions help maintain the structural integrity and functional properties of the recombinant GPR153 protein.

Experimental Applications

Recombinant GPR153 proteins serve as valuable tools for a variety of experimental applications. His-tagged variants are particularly useful for protein-protein interaction studies, antibody production, and structural analyses. The availability of the full amino acid sequence and predicted structure facilitates the design of targeted investigations into specific domains or residues of interest.

For cellular studies, the GFP-tagged variants enable real-time visualization of receptor trafficking and localization . These constructs can be transfected into appropriate mammalian cell lines using standard transfection protocols, with selection for stable expression possible using the neomycin resistance marker . Such cellular models provide platforms for screening potential ligands and investigating signaling pathways associated with GPR153 activation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be defined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
GPR153; PGR1; Probable G-protein coupled receptor 153; G-protein coupled receptor PGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVP IATYSVVQLRRQRPDFEWNEGLCKVFVSTFYTLTLATCFSVTSLSYHRMWMVCWPVNYRL SNAKKQAVHTVMGIWMVSFILSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLV GGSVAMGVICTAIALFQTLAVQVGRQADRRAFTVPTIVVEDAQGKRRSSIDGSEPAKTSL QTTGLVTTIVFIYDCLMGFPVLVVSFSSLRADASAPWMALCVLWCSVAQALLLPVFLWAC DRYRADLKAVREKCMALMANDEESDDETSLEGGISPDLVLERSLDYGYGGDFVALDRMAK YEISALEGGLPQLYPLRPLQEDKMQYLQVPPTRRFSHDDADVWAAVPLPAFLPRWGSGED LAALAHLVLPAGPERRRASLLAFAEDAPPSRARRRSAESLLSLRPSALDSGPRGARDSPP GSPRRRPGPGPRSASASLLPDAFALTAFECEPQALRRPPGPFPAAPAAPDGADPGEAPTP PSSAQRSPGPRPSAHSHAGSLRPGLSASWGEPGGLRAAGGGGSTSSFLSSPSESSGYATL HSDSLGSAS
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links

HGNC: 23618

KEGG: hsa:387509

STRING: 9606.ENSP00000367125

UniGene: Hs.531581

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR153 and which protein family does it belong to?

GPR153 is an orphan G-protein coupled receptor that belongs to the Rhodopsin family of GPCRs. Specifically, phylogenetic analyses have placed GPR153 in the α-group of the Rhodopsin family . This is particularly significant because the α-group is the only GPCR group that contains numerous receptors for biogenic amines, which represent major drug targets in pharmaceutical research . The human GPR153 is encoded by the GPR153 gene located at chromosome 1p36.31 and produces a protein with a molecular mass of 65,361 Da . The receptor consists of 609 amino acids and contains the characteristic seven transmembrane domains typical of GPCRs .

How evolutionarily conserved is GPR153?

GPR153 demonstrates significant evolutionary conservation across multiple species. The GPR153 gene has been identified in chimpanzees, Rhesus monkeys, dogs, cows, mice, rats, chickens, frogs, and zebrafish, indicating strong conservation throughout vertebrate evolution . Phylogenetic and synteny analyses have revealed that GPR153 and GPR162 share a common ancestral gene that likely underwent a duplication event prior to the divergence of tetrapods and the teleost lineage . Researchers have identified GPR153 homologues in the elephant shark genome, suggesting that this receptor appeared early in vertebrate evolution . This high degree of conservation across species indicates that GPR153 likely serves fundamental biological functions that have been maintained throughout vertebrate evolution.

What is the expression pattern of GPR153 in tissues?

GPR153 exhibits a widespread expression pattern across both central nervous system and peripheral tissues. Quantitative real-time PCR studies have demonstrated that GPR153 is expressed throughout the central nervous system, with particularly high expression in specific brain regions . In situ hybridization studies on mouse brain have revealed notably high expression in the thalamus, cerebellum, and the arcuate nucleus . Analysis of single-cell data from human skin has confirmed the expression of GPR153 in both basal and differentiated (suprabasal) keratinocytes . Additionally, GPR153 has been found in the anterior pituitary of heifers, with some GPR153 colocalizing with gonadotropin-releasing hormone receptor (GnRHR) in the plasma membrane of bovine gonadotrophs, suggesting a potential role in reproductive processes . The expression level of GPR153 in the anterior pituitary appears to be dependent on reproductive stage .

How can recombinant GPR153 protein be properly handled and stored for research applications?

The optimal handling and storage of recombinant GPR153 requires specific conditions to maintain protein integrity and functionality. Recombinant human GPR153 protein is typically supplied as a lyophilized powder . Prior to opening, it is recommended that the vial be briefly centrifuged to bring all contents to the bottom . For reconstitution, the protein should be dissolved in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

For long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard concentration used by many suppliers . After reconstitution, the protein solution should be aliquoted to avoid repeated freeze-thaw cycles, which can degrade the protein . Working aliquots can be stored at 4°C for up to one week, while long-term storage requires temperatures of -20°C to -80°C . The storage buffer typically consists of a Tris/PBS-based solution with 6% trehalose at pH 8.0, which helps maintain protein stability .

What experimental approaches have been used to study GPR153 function?

Several experimental approaches have been utilized to investigate the functional role of GPR153:

  • Antisense Oligodeoxynucleotide Knockdown: This technique has been employed to reduce GPR153 expression in vivo, allowing researchers to observe resulting phenotypes. Studies using this approach have shown that GPR153 knockdown causes a slight reduction in food intake, suggesting a potential role in appetite regulation .

  • Behavioral Testing: The elevated plus maze test following GPR153 knockdown has revealed a significant reduction in the percentage of time spent in the center square, indicating a possible role for GPR153 in decision-making processes or anxiety-related behaviors .

  • siRNA-Mediated Gene Silencing: In cultured keratinocytes, siRNA-mediated knockdown of GPR153 has been used to study its role in cellular processes. This approach demonstrated that GPR153 knockdown reduced keratinocyte proliferation but, unlike other GPCRs studied, did not affect differentiation .

  • Transcriptomic Analysis: RNA sequencing following GPR153 knockdown has revealed that GPR153 regulates gene networks involved in both keratinocyte differentiation and cell cycle, though its knockdown was shown to downregulate both processes .

  • 3D Skin-Organotypic Culture Models: Unlike other GPCRs tested (LTB4R, HCAR3, and GPR137), GPR153 overexpression did not appear to affect skin development in these models, suggesting specificity in its functional role .

What are the recommended techniques for analyzing GPR153 expression in tissue samples?

For comprehensive analysis of GPR153 expression in tissue samples, researchers have successfully employed multiple complementary techniques:

  • Quantitative Real-Time PCR (qRT-PCR): This technique has been used to quantify GPR153 mRNA expression across various tissues, providing a broad overview of expression patterns. When conducting qRT-PCR for GPR153, appropriate reference genes such as cyclophilin or GAPDH should be used for normalization .

  • In Situ Hybridization: This method provides detailed spatial information about GPR153 expression within tissues. It has been particularly valuable for mapping GPR153 expression in specific brain regions, revealing high expression in the thalamus, cerebellum, and arcuate nucleus .

  • Single-Cell RNA Sequencing Analysis: Analysis of single-cell datasets has confirmed GPR153 expression in specific cell populations, such as basal and differentiated keratinocytes in human skin .

  • Immunohistochemistry/Immunofluorescence: Although not explicitly mentioned in the provided search results, antibody-based detection methods would be appropriate for visualizing GPR153 protein localization within tissues.

  • Co-localization Studies: These have been used to demonstrate that GPR153 colocalizes with other proteins of interest, such as GnRHR in bovine gonadotrophs, providing insights into potential functional interactions .

What is known about GPR153 signaling pathways and potential ligands?

GPR153 remains classified as an orphan receptor, meaning its endogenous ligand(s) have not yet been definitively identified . This presents a significant challenge and opportunity in GPCR research. As a member of the α-group of Rhodopsin family GPCRs, which includes many receptors for biogenic amines, it is possible that GPR153 might respond to similar types of signaling molecules, though this remains speculative .

The fact that GPR153 colocalizes with GnRHR in bovine gonadotrophs and its expression is dependent on reproductive stage suggests a potential role in reproductive hormone signaling pathways, though the precise mechanism requires further investigation . Methodological approaches to identify GPR153 ligands might include screening of compound libraries, proximity labeling techniques, or targeted metabolomic analyses focusing on biogenic amines given its phylogenetic placement.

How does GPR153 compare functionally with its evolutionary relative GPR162?

Phylogenetic and synteny analyses have established that GPR153 and GPR162 share a common ancestral gene that likely underwent a duplication event prior to the divergence of tetrapods and the teleost lineage . Despite this shared evolutionary origin, the functional relationship between these two receptors remains largely unexplored.

To investigate potential functional similarities or differences between GPR153 and GPR162, comparative studies examining expression patterns, knockdown phenotypes, and potential signaling pathways would be valuable. Methodological approaches could include:

  • Comparative Expression Analysis: Simultaneous mapping of GPR153 and GPR162 expression patterns across tissues to identify areas of overlap or distinction.

  • Parallel Knockdown/Knockout Studies: Comparing phenotypic effects of GPR153 and GPR162 depletion, both individually and in combination, to reveal potential functional redundancy or divergence.

  • Chimeric Receptor Studies: Creating chimeric receptors containing domains from both GPR153 and GPR162 to identify regions responsible for specific functional properties.

  • Co-immunoprecipitation Experiments: Investigating whether GPR153 and GPR162 physically interact or form heterodimers, which could suggest coordinated functions.

  • Comparative Ligand Screening: Once candidate ligands are identified for either receptor, testing their activity on both GPR153 and GPR162 to determine specificity or cross-reactivity.

What role does GPR153 play in keratinocyte biology and skin homeostasis?

Research has demonstrated that GPR153 is expressed in both basal and differentiated (suprabasal) keratinocytes in human skin . Functional studies using siRNA-mediated knockdown have revealed that GPR153 regulates keratinocyte proliferation, as its depletion led to reduced proliferation in both primary human keratinocytes and immortalized N/TERT2G keratinocytes . This effect was observed in both full media (containing bovine pituitary extract) and defined media, indicating that the role of GPR153 in keratinocyte proliferation is not dependent on potential ligands present in pituitary extract .

Transcriptomic analysis following GPR153 knockdown showed downregulation of both keratinocyte differentiation and cell cycle networks . This differs from the effects observed with other GPCRs such as LTB4R, HCAR3, and GPR137, which upregulated differentiation while downregulating cell cycle processes . Unlike these other receptors, GPR153 knockdown did not upregulate genes associated with keratinocyte differentiation .

Furthermore, while overexpression of LTB4R, HCAR3, and GPR137 led to abnormal development in 3D skin-organotypic cultures, GPR153 overexpression did not affect skin development in these models . This suggests that GPR153 may have a more specific role in regulating keratinocyte proliferation without directly influencing differentiation processes.

Methodologically, investigations into the role of GPR153 in skin biology have employed:

  • siRNA-mediated knockdown in keratinocyte cultures

  • RNA sequencing to identify affected gene networks

  • Western blot analysis for differentiation markers

  • 3D skin-organotypic culture models

What are the implications of GPR153 expression in the thalamus, cerebellum, and arcuate nucleus?

The finding that GPR153 is highly expressed in the thalamus, cerebellum, and arcuate nucleus suggests potential roles in several key neurological functions :

  • Thalamic Expression: The thalamus serves as a relay center for sensory and motor signals to the cerebral cortex and regulates consciousness, sleep, and alertness. GPR153's high expression in this region suggests it may contribute to these processes. Methodological approaches to investigate this could include electrophysiological recordings in thalamic slices following GPR153 manipulation, or behavioral testing of sensory processing and sleep patterns in GPR153 knockdown models.

  • Cerebellar Expression: The cerebellum coordinates motor movements and is involved in certain cognitive functions. GPR153's expression here indicates a potential role in motor control or cerebellar cognitive functions. Research methodologies might include detailed motor testing in GPR153-deficient animals or cerebellar slice electrophysiology.

  • Arcuate Nucleus Expression: The arcuate nucleus in the hypothalamus is critical for feeding behavior and energy homeostasis. This aligns with the observation that antisense oligodeoxynucleotide knockdown of GPR153 caused a slight reduction in food intake . Further investigation could employ methodologies such as hypothalamic slice recordings, metabolic chamber studies, or feeding behavior analysis following more targeted manipulation of GPR153 specifically in the arcuate nucleus.

  • Decision-Making Processes: The finding that GPR153 knockdown led to reduced time spent in the center square of the elevated plus maze suggests a potential role in decision-making processes or anxiety-related behaviors . This could be further investigated using additional behavioral paradigms such as the open field test, light/dark box, or decision-making tasks.

What are the current challenges in studying orphan receptors like GPR153?

Studying orphan GPCRs like GPR153 presents several technical challenges:

  • Unknown Endogenous Ligands: The lack of identified endogenous ligand(s) for GPR153 makes it difficult to study receptor activation and signaling under physiological conditions . This necessitates alternative approaches such as knockdown/knockout studies or overexpression of constitutively active mutants.

  • Limited Pharmacological Tools: Without known ligands, there is a scarcity of specific agonists, antagonists, or allosteric modulators for GPR153, limiting the ability to manipulate receptor function acutely and specifically.

  • Potential Constitutive Activity: Many orphan receptors exhibit constitutive (ligand-independent) activity, which can complicate the interpretation of experimental results, particularly in overexpression studies.

  • Membrane Protein Expression Challenges: As a seven-transmembrane protein, GPR153 may present difficulties for structural studies due to challenges in expressing, purifying, and crystallizing membrane proteins while maintaining their native conformation.

To address these challenges, researchers might consider:

  • Ligand Identification Strategies: Employing techniques such as reverse pharmacology, metabolomics-based approaches, or computational screening to identify potential ligands.

  • CRISPR-Cas9 Genome Editing: Generating targeted knockouts or introducing reporter tags at endogenous loci to study receptor function and localization without overexpression artifacts.

  • Single-Cell Analyses: Utilizing single-cell transcriptomics and proteomics to identify cell populations where GPR153 is highly expressed, potentially narrowing down physiological contexts for functional studies.

  • Proximity Labeling Techniques: Employing methods such as BioID or APEX to identify proteins that physically interact with GPR153, potentially revealing components of its signaling pathways.

How can researchers design experiments to identify potential ligands for GPR153?

Identifying ligands for orphan receptors like GPR153 requires strategic experimental approaches:

  • Phylogenetic-Based Screening: Since GPR153 belongs to the α-group of Rhodopsin family GPCRs, which includes many receptors for biogenic amines, a targeted screening approach focusing on structurally related biogenic amines and their derivatives would be a logical starting point .

  • Cell-Based Functional Assays: Developing cell lines stably expressing GPR153 coupled to various readout systems (calcium flux, cAMP production, β-arrestin recruitment, etc.) to screen compound libraries for potential agonist or antagonist activity.

  • Tissue-Specific Metabolomics: Given GPR153's high expression in specific brain regions and skin, analyzing the metabolome of these tissues could identify candidate endogenous ligands. Comparing metabolites between wild-type and GPR153-knockout tissues might reveal accumulation or depletion of potential ligands.

  • Computational Approaches: Using molecular docking and virtual screening to predict compounds that might bind to the GPR153 binding pocket, based on homology models derived from structurally characterized GPCRs.

  • Receptor Capture Technologies: Employing chemical biology approaches such as photoaffinity labeling or chemical crosslinking to capture endogenous ligands that interact with GPR153 in native tissues.

  • Phenotypic Screening: Testing compounds for their ability to rescue or mimic phenotypes observed in GPR153 knockdown models, such as effects on keratinocyte proliferation or feeding behavior.

What future research directions might advance our understanding of GPR153 function?

Several promising research directions could significantly advance our understanding of GPR153:

  • Comprehensive Tissue-Specific Knockout Studies: Generating conditional knockout models to eliminate GPR153 expression in specific tissues (brain regions, skin, anterior pituitary) to dissect its tissue-specific functions without developmental compensation.

  • Structure Determination: Resolving the three-dimensional structure of GPR153 through cryo-electron microscopy or X-ray crystallography would provide invaluable insights into its potential ligand binding sites and activation mechanism.

  • Signaling Pathway Characterization: Systematic investigation of G protein coupling preferences and downstream signaling pathways activated by GPR153, particularly in cellular contexts where it shows high expression.

  • Disease Association Studies: Examining potential associations between GPR153 genetic variants and human diseases, particularly those affecting the central nervous system, skin, or reproductive function.

  • Developmental Expression Analysis: Characterizing the temporal expression pattern of GPR153 during embryonic and postnatal development could reveal critical periods where it might play essential roles.

  • Interactome Mapping: Identifying proteins that physically interact with GPR153 could reveal functional partners and provide clues about its physiological roles.

  • Cross-Species Comparative Studies: Given the evolutionary conservation of GPR153, comparative studies across different species could highlight conserved functions and potentially simplify experimental approaches in model organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.