Recombinant Human Probable G-protein coupled receptor 162 (GPR162)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
GPR162; GRCA; Probable G-protein coupled receptor 162; Gene-rich cluster gene A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MARGGAGAEEASLRSNALSWLACGLLALLANAWIILSISAKQQKHKPLELLLCFLAGTHI LMAAVPLTTFAVVQLRRQASSDYDWNESICKVFVSTYYTLALATCFTVASLSYHRMWMVR WPVNYRLSNAKKQALHAVMGIWMVSFILSTLPSIGWHNNGERYYARGCQFIVSKIGLGFG VCFSLLLLGGIVMGLVCVAITFYQTLWARPRRARQARRVGGGGGTKAGGPGALGTRPAFE VPAIVVEDARGKRRSSLDGSESAKTSLQVTNLVSAIVFLYDSLTGVPILVVSFFSLKSDS APPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYA EGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIF STPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLR QFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSL GSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. Data suggest that certain single nucleotide polymorphism (SNP) variants in the GPR162 gene are associated with impaired glucose homeostasis in obese patients. PMID: 26827797
Database Links

HGNC: 16693

KEGG: hsa:27239

STRING: 9606.ENSP00000311528

UniGene: Hs.631654

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR162 and how is it classified among G-protein coupled receptors?

GPR162 is classified as a class A, rhodopsin-like G protein-coupled receptor (GPCR) that remains categorized as an orphan receptor, meaning its endogenous ligand has not yet been identified. The receptor belongs to the larger GPCR superfamily, which constitutes the largest class of membrane proteins involved in signal transduction across the plasma membrane. Structurally, GPR162 exhibits the characteristic seven-transmembrane domain architecture typical of GPCRs, with an extracellular N-terminus and an intracellular C-terminus involved in downstream signaling pathways .

Research indicates that GPR162 is abundantly expressed in the plasma membrane and mitochondrial membrane, with smaller quantities detected in the nucleus and extracellular space, suggesting diverse subcellular functions . This distribution pattern may explain its involvement in multiple cellular signaling pathways, particularly those related to inflammatory responses and DNA damage repair mechanisms.

What is the tissue distribution pattern of GPR162 expression?

GPR162 demonstrates a distinct tissue expression pattern that provides insights into its physiological functions. The receptor is widely expressed in neuronal tissues, particularly in GABAergic neurons within the mouse hippocampus. Extensive expression is also observed in brain regions associated with energy homeostasis and reward pathways, including the hypothalamus, amygdala, and ventral tegmental area .

In the context of cancerous versus normal tissues, GPR162 exhibits significantly lower expression in almost all solid tumors compared to corresponding normal tissues. This differential expression pattern has been documented across multiple cancer types, including lung adenocarcinoma, hepatocellular carcinoma, and breast cancer . The reduced expression in malignant tissues suggests potential tumor-suppressive functions of GPR162, which correlates with clinical observations that higher GPR162 expression is associated with better prognosis in several cancer types.

What are the known signaling pathways associated with GPR162 activation?

While GPR162 remains an orphan receptor without a definitively identified endogenous ligand, research has uncovered several downstream signaling pathways activated by this receptor:

  • STING-dependent pathway: GPR162 interacts directly with the stimulator of interferon genes (STING), activating this pathway independent of the classical cGAS-mediated mechanism. This interaction occurs primarily at the mitochondria and endoplasmic reticulum .

  • Type I Interferon signaling: Following STING activation, GPR162 promotes phosphorylation of TBK1 and IRF3, leading to IRF3 nuclear translocation and subsequent type I interferon gene transcription .

  • Chemokine production: GPR162 activation upregulates the expression of specific chemokines, including CXCL10 and CXCL4, which play essential roles in immune cell recruitment and anti-tumor responses .

  • DNA damage response pathways: GPR162 has been implicated in DNA damage response mechanisms, particularly enhancing sensitivity to radiation-induced DNA damage .

These signaling cascades collectively contribute to GPR162's role in tumor suppression, radiotherapy sensitization, and potentially immune modulation.

What are the recommended protocols for detecting GPR162 expression in tissue samples?

For comprehensive analysis of GPR162 expression in tissue samples, a multi-modal approach combining the following techniques is recommended:

Immunohistochemistry (IHC): This method allows visualization of GPR162 protein expression in tissue sections and enables comparison between tumor and adjacent normal tissues. The recommended protocol includes:

  • Formalin fixation and paraffin embedding of tissue samples

  • Antigen retrieval using citrate buffer (pH 6.0)

  • Incubation with validated anti-GPR162 primary antibody (1:100-1:200 dilution)

  • Detection using DAB (3,3'-diaminobenzidine) and counterstaining with hematoxylin

  • Scoring based on staining intensity and percentage of positive cells

In Situ Hybridization (ISH): For mRNA detection, particularly useful for anatomical characterization in brain tissues:

  • Use of digoxigenin-labeled riboprobes targeting GPR162 mRNA

  • Hybridization at 65°C overnight

  • Detection using alkaline phosphatase-conjugated anti-digoxigenin antibodies

  • Visualization with NBT/BCIP substrate

RT-qPCR: For quantitative assessment of GPR162 mRNA levels:

  • Total RNA extraction using TRIzol reagent

  • cDNA synthesis with oligo(dT) primers

  • qPCR with primers specific to GPR162

  • Normalization to housekeeping genes (GAPDH, ACTB, or 18S rRNA)

Western Blot Analysis: For protein quantification:

  • Protein extraction using RIPA buffer supplemented with protease inhibitors

  • Separation on 10% SDS-PAGE gels

  • Transfer to PVDF membranes

  • Probing with anti-GPR162 antibody (1:1000 dilution)

  • Detection using chemiluminescence reagents

Each method provides complementary information, with IHC and ISH offering spatial resolution, while RT-qPCR and Western blot provide quantitative measurements.

How can researchers effectively overexpress or knockdown GPR162 in experimental models?

For GPR162 Overexpression:

For GPR162 Knockdown/Knockout:

  • siRNA approach:

    • Design multiple siRNA sequences targeting different regions of GPR162 mRNA

    • Transfect using lipid-based reagents at 25-50 nM concentration

    • Validate knockdown efficiency after 48-72 hours by RT-qPCR and Western blot

    • Include non-targeting siRNA controls

  • shRNA approach (for stable knockdown):

    • Design shRNA sequences based on effective siRNA targets

    • Clone into lentiviral vectors with appropriate selection markers

    • Transduce cells and select stable integrants

    • Validate knockdown persistence over multiple passages

  • CRISPR-Cas9 gene editing:

    • Design sgRNAs targeting early exons of GPR162

    • Use dual-guide approach for more efficient knockout

    • Screen clones using PCR, sequencing, and Western blot

    • Generate heterozygous and homozygous knockout lines for comparative studies

  • Antisense oligonucleotides:

    • Particularly effective for in vivo applications

    • Design phosphorothioate-modified antisense oligonucleotides

    • Administer via direct injection into target tissues

    • Monitor knockdown efficiency by RT-qPCR

The choice of method depends on the experimental duration, model system, and whether transient or stable modulation is required.

What techniques are most effective for studying GPR162-STING interactions?

Investigating the interaction between GPR162 and STING requires specialized techniques that can capture protein-protein interactions in their native cellular context:

Co-immunoprecipitation (Co-IP):

  • Lyse cells in non-denaturing buffers containing mild detergents (e.g., NP-40 or CHAPS)

  • Immunoprecipitate GPR162 using specific antibodies or epitope tags

  • Analyze precipitates for STING by Western blot

  • Include appropriate controls: IgG control, knockout/knockdown validation

  • Both endogenous and exogenous (overexpressed) protein interactions should be assessed

Proximity Ligation Assay (PLA):

  • This technique allows visualization of protein interactions in situ

  • Fix cells and incubate with primary antibodies against GPR162 and STING

  • Apply secondary antibodies with conjugated oligonucleotides

  • Ligation and rolling circle amplification create fluorescent spots where proteins interact

  • Quantify interaction points using fluorescence microscopy

Fluorescence Resonance Energy Transfer (FRET):

  • Tag GPR162 and STING with compatible fluorophores (e.g., CFP-YFP or GFP-RFP pairs)

  • Express in target cells and measure energy transfer using spectral imaging

  • Calculate FRET efficiency as a measure of protein proximity

  • Perform acceptor photobleaching to confirm specific interaction

Bimolecular Fluorescence Complementation (BiFC):

  • Split a fluorescent protein (e.g., Venus or YFP) into non-fluorescent N- and C-terminal fragments

  • Fuse these fragments to GPR162 and STING respectively

  • Co-expression results in fluorescence only when proteins interact

  • Determine subcellular localization of interaction using confocal microscopy

Mass Spectrometry-Based Approaches:

  • Perform immunoprecipitation of GPR162 followed by mass spectrometry

  • Use quantitative approaches such as SILAC or TMT labeling

  • Identify interaction domains through analysis of peptide fragments

  • Validate key findings with targeted approaches listed above

Previous research has successfully used these methods to demonstrate that GPR162 directly interacts with STING in mitochondria and endoplasmic reticulum, providing a mechanistic basis for GPR162's role in activating STING-dependent signaling pathways.

How does GPR162 expression correlate with cancer prognosis across different tumor types?

Analysis of GPR162 expression across multiple cancer types reveals a consistent pattern of reduced expression in malignant tissues compared to normal counterparts. This expression profile has significant prognostic implications:

Expression Patterns and Survival Correlation:

Comprehensive analysis of The Cancer Genome Atlas (TCGA) data demonstrates that GPR162 expression is downregulated in most solid tumors compared to corresponding normal tissues. Higher GPR162 expression correlates with improved patient outcomes in several cancer types, including:

Tissue-Specific Immunohistochemistry Findings:

Immunohistochemical analysis of clinical tissue samples consistently shows reduced GPR162 expression in tumor tissues:

  • In lung cancer tissues, GPR162 immunohistochemistry scores are significantly lower than in adjacent normal tissues (mean score: 1.8 vs. 4.2, p<0.001)

  • Similar patterns are observed in liver cancer, with reduced staining intensity in malignant cells

These findings collectively suggest that GPR162 may function as a tumor suppressor, with its loss potentially contributing to cancer progression and poorer clinical outcomes. The consistent association between higher GPR162 expression and better survival across multiple cancer types reinforces its potential utility as a prognostic biomarker.

What is the mechanism by which GPR162 sensitizes cancer cells to radiotherapy?

GPR162 enhances radiosensitivity through multiple interconnected mechanisms, primarily involving DNA damage response pathways and immune modulation:

DNA Damage Response Enhancement:

  • Direct involvement in DNA damage recognition: GPR162 enters the nucleus in large quantities during the M phase of the cell cycle and colocalizes with γH2AX, a marker of DNA double-strand breaks, suggesting direct participation in DNA damage recognition and processing .

  • Impaired DNA repair capacity: Overexpression of GPR162 leads to persistent γH2AX foci following radiation, indicating delayed or defective DNA damage repair. This is evidenced by significantly lower clonogenic survival in GPR162-overexpressing cells following irradiation .

  • Cell cycle effects: GPR162 may modulate cell cycle checkpoints, preventing cells with damaged DNA from progressing through the cell cycle, thereby enhancing radiation-induced cell death .

STING-Dependent Immune Activation:

  • Cytosolic DNA sensing: GPR162 promotes the release of DNA from the nucleus into the cytoplasm following radiation damage, activating the STING pathway independently of the canonical cGAS-mediated sensing mechanism .

  • Type I interferon production: Following STING activation, GPR162 enhances phosphorylation of IRF3 and TBK1, leading to increased type I interferon production. This creates an inflammatory microenvironment hostile to tumor cells .

  • Chemokine induction: GPR162-mediated STING activation increases expression of chemokines CXCL10 and CXCL4, which recruit immune cells to the tumor microenvironment, amplifying anti-tumor immune responses .

Cellular and Structural Changes:

Transmission electron microscopy (TEM) reveals that GPR162-overexpressing cells subjected to radiation exhibit more severe structural damage, including:

  • Reduced number of mitochondria

  • Swelling of outer mitochondrial compartments

  • Thickening of mitochondrial ridges

  • Endoplasmic reticulum expansion

  • Increased nuclear pore numbers

  • Nearly irreversible death trajectory

These findings indicate that GPR162 serves as a radiosensitizer by enhancing DNA damage responses, promoting cytosolic DNA sensing, activating type I interferon responses, and inducing structural changes that collectively amplify radiation-induced cell death. The STING-dependent pathway appears central to this radiosensitizing effect, as STING inhibitors can reverse the enhanced anti-tumor effect of GPR162 overexpression in irradiated mouse models .

How does the STING pathway activation by GPR162 differ from the classical cGAS-STING pathway?

The activation of STING by GPR162 represents a non-canonical pathway that diverges from the well-characterized cGAS-STING axis in several key aspects:

Classical cGAS-STING Pathway:

  • Initiated by cytosolic DNA recognition by cyclic GMP-AMP synthase (cGAS)

  • cGAS catalyzes the formation of 2'3'-cyclic GMP-AMP (cGAMP) from ATP and GTP

  • cGAMP binds to STING at the endoplasmic reticulum

  • STING undergoes conformational changes and translocation to perinuclear regions

  • Activates TBK1 and IRF3, leading to type I interferon production

GPR162-Mediated STING Activation:

  • Functions independently of cGAS

  • Involves direct protein-protein interaction between GPR162 and STING

  • Interaction primarily occurs at the endoplasmic reticulum and mitochondrial membranes

  • Does not require cGAMP as an intermediate signaling molecule

  • Still results in downstream phosphorylation of TBK1 and IRF3

Evidence Supporting the Non-Canonical Pathway:

  • Direct protein interaction: Co-immunoprecipitation and mass spectrometry analyses demonstrate that GPR162 physically interacts with STING, suggesting direct activation .

  • Independence from cGAS: RNA sequencing and GSEA analysis of GPR162-overexpressing cells show that the effects persist in contexts where cGAS is inactive or absent .

  • Subcellular localization: GPR162 and STING colocalize at the endoplasmic reticulum and mitochondrial membranes, supporting a direct interaction model rather than the canonical cytosolic DNA sensing mechanism .

  • Response to STING inhibitors: The antitumor effects of GPR162 overexpression can be reversed by STING inhibitors in irradiated mouse models, confirming that STING activation is essential for GPR162's function .

This alternative pathway for STING activation expands our understanding of DNA damage response signaling and offers potential new therapeutic targets. The GPR162-STING axis may be particularly important in contexts where the canonical cGAS-STING pathway is dysregulated or insufficient, such as in cancer cells that have evolved mechanisms to evade cytosolic DNA sensing.

What is the relationship between GPR162 and glucose homeostasis?

GPR162 appears to play a significant role in glucose metabolism and homeostasis, with evidence spanning from genetic association studies to functional experiments:

Genetic Associations with Metabolic Parameters:

Human genetic studies have identified variants in the GPR162 gene that are associated with impairments in glucose homeostasis. These findings represent the first documented connection between GPR162 genetics and metabolic dysfunction in human populations . The specific variants and their functional consequences include:

  • Single nucleotide polymorphisms (SNPs) in regulatory regions affecting GPR162 expression levels

  • Coding variants potentially altering receptor function or ligand binding properties

  • Association with altered fasting glucose levels, insulin sensitivity, and glucose tolerance

Neuroanatomical Basis for Metabolic Effects:

GPR162's extensive expression in brain regions controlling energy balance provides a neuroanatomical substrate for its influence on glucose homeostasis:

  • Abundant expression in hypothalamic nuclei, particularly those involved in glucose sensing and energy homeostasis regulation

  • Presence in ventromedial hypothalamus and arcuate nucleus neurons that regulate hepatic glucose production and peripheral glucose utilization

  • Expression in amygdala and ventral tegmental area, which influence reward-related aspects of feeding behavior and can indirectly affect glucose metabolism

Functional Evidence from Experimental Models:

Antisense knockdown studies targeting GPR162 have demonstrated functional effects on food intake-related behaviors, which may indirectly influence glucose homeostasis through alterations in energy balance . While the exact molecular mechanisms remain to be fully elucidated, these findings suggest that GPR162 might:

  • Modulate hypothalamic sensing of circulating glucose levels

  • Influence the release of neuropeptides regulating peripheral glucose metabolism

  • Affect neuronal circuits coordinating feeding behavior with metabolic needs

The relationship between GPR162 and glucose homeostasis represents an emerging area of research with potential implications for understanding metabolic disorders and developing novel therapeutic approaches. The receptor's presence in key brain regions regulating energy homeostasis positions it as an interesting target for further investigation in the context of diabetes, obesity, and related metabolic conditions.

How is GPR162 involved in neuronal signaling and behavior regulation?

GPR162 demonstrates significant expression in neural tissues and appears to modulate several aspects of neuronal function and behavior:

Neuroanatomical Distribution:

GPR162 shows a distinct expression pattern in the brain, with particularly high levels in:

  • GABAergic neurons in the hippocampus, suggesting a role in inhibitory neurotransmission

  • Hypothalamic nuclei involved in feeding behavior and energy homeostasis

  • Amygdala, which processes emotional responses including fear and reward

  • Ventral tegmental area, a key component of the brain's reward circuitry

This distribution pattern aligns with potential roles in both cognitive function and basic physiological regulation.

Neurotransmitter Systems:

GPR162's predominant expression in GABAergic neurons suggests interaction with inhibitory neurotransmission. While its precise signaling mechanisms remain to be fully characterized, GPR162 may:

  • Modulate GABA release or reuptake

  • Influence GABAergic neuron excitability

  • Interact with other neurotransmitter systems in regions of co-expression

Behavioral Regulation:

Experimental evidence from antisense knockdown studies indicates that GPR162 influences food intake-related behaviors, pointing to functional roles in:

  • Appetite regulation and feeding behavior

  • Reward processing and hedonic aspects of feeding

  • Energy homeostasis at the behavioral level

These findings suggest GPR162 may participate in the complex neural circuits that integrate metabolic signals with behavioral outputs, particularly those related to feeding and energy balance.

Clinical Implications:

The neuroanatomical distribution and functional evidence position GPR162 as a potential target for conditions involving dysregulation of feeding behavior and reward processing, including:

  • Eating disorders

  • Obesity

  • Substance use disorders

  • Mood disorders with altered reward sensitivity

While research in this area remains in early stages, the involvement of GPR162 in neural circuits regulating fundamental behaviors makes it an interesting candidate for further investigation in neuropsychiatric and metabolic conditions.

What are the current challenges in developing specific agonists or antagonists for GPR162?

Developing pharmacological tools for GPR162 faces several significant challenges that have hindered progress in this area:

Orphan Receptor Status:

The primary challenge stems from GPR162's classification as an orphan receptor:

  • No endogenous ligand has been definitively identified

  • Lack of known natural ligands complicates rational drug design approaches

  • Without a reference ligand, structure-activity relationship studies are difficult to establish

Structural Considerations:

Limited structural information presents significant obstacles:

  • No crystal structure or cryo-EM structure of GPR162 is currently available

  • Homology models based on related GPCRs may lack accuracy due to potential unique structural features of GPR162

  • Binding pocket characteristics remain largely theoretical without experimental validation

  • Membrane localization complicates structural studies that would facilitate drug design

Functional Assay Development:

Challenges in developing reliable screening assays include:

  • Uncertainty regarding the primary G-protein coupling profile of GPR162

  • Unclear second messenger systems linked to receptor activation

  • Lack of validated cell-based assays for high-throughput screening

  • Need for multiple orthogonal assays to confirm true agonist/antagonist activity versus off-target effects

Future Strategies:

Despite these challenges, several approaches show promise for developing GPR162-targeted compounds:

  • Computational approaches: Advanced molecular docking and virtual screening using refined homology models

  • Fragment-based drug discovery: Identifying small molecular fragments that bind to different receptor regions

  • DNA-encoded library screening: Testing vast chemical libraries for binding to the receptor

  • Functional genomics approaches: CRISPR screens to identify pathways and potential endogenous ligands

  • Phenotypic screening: Identifying compounds that mimic GPR162 overexpression phenotypes

Overcoming these challenges would enable more precise investigation of GPR162's functions and potentially lead to therapeutic applications, particularly in cancer treatment where enhancing GPR162 activity might sensitize tumors to radiotherapy or reactivate anti-tumor immune responses.

What is the potential for developing GPR162-based cancer therapies?

Based on the current understanding of GPR162 biology, several promising therapeutic strategies could leverage this receptor in cancer treatment:

Radiotherapy Sensitization Approaches:

GPR162's ability to enhance radiation sensitivity in cancer cells presents a compelling therapeutic opportunity:

  • Gene therapy approaches: Delivering GPR162 expression vectors to tumors could increase their sensitivity to radiation treatment

  • Small molecule enhancers: Compounds that increase GPR162 expression or activity could serve as radiosensitizers

  • Combination therapy protocols: Integrating GPR162-targeting approaches with standard radiotherapy regimens to improve efficacy while potentially reducing required radiation doses

Immune Modulation Strategies:

The activation of STING-dependent pathways by GPR162 suggests potential for immuno-oncology applications:

  • Enhanced T-cell recruitment: GPR162-mediated production of chemokines (CXCL10, CXCL4) could improve immune cell infiltration into tumors

  • Synergy with immune checkpoint inhibitors: Combining GPR162 activation with anti-PD-1/PD-L1 therapies might overcome resistance mechanisms

  • Type I interferon induction: GPR162-stimulated interferon production could create favorable conditions for anti-tumor immunity

Diagnostic and Prognostic Applications:

Beyond direct therapeutic targeting:

  • Biomarker development: GPR162 expression levels could serve as a prognostic indicator across multiple cancer types

  • Patient stratification: Identifying patients with low GPR162 expression who might benefit from specific therapeutic approaches

  • Treatment response prediction: Using GPR162 status to predict radiotherapy sensitivity

Challenges and Considerations:

Several factors will influence the clinical translation of GPR162-based cancer therapies:

  • Delivery methods: Developing effective means to enhance GPR162 expression or activity specifically in tumor cells

  • Tissue specificity: Ensuring therapeutic approaches target cancer cells while sparing normal tissues

  • Resistance mechanisms: Understanding potential compensatory pathways that might emerge upon GPR162 targeting

  • Patient selection: Identifying biomarkers to predict which patients would most benefit from GPR162-based therapies

The therapeutic potential of GPR162 is particularly promising given its consistently reduced expression across multiple cancer types and its demonstrated anti-tumor effects when overexpressed. As understanding of its signaling mechanisms and regulatory networks expands, more refined therapeutic approaches targeting this receptor or its downstream pathways may emerge.

How might GPR162 research intersect with other emerging areas in molecular and cellular biology?

GPR162 research intersects with several cutting-edge fields in molecular and cellular biology, creating opportunities for interdisciplinary approaches:

Integration with DNA Damage Response Research:

GPR162's involvement in DNA damage pathways connects to advances in:

  • DNA repair mechanisms: Understanding how GPR162 modifies repair kinetics and pathway choice between homologous recombination and non-homologous end joining

  • Synthetic lethality approaches: Identifying potential combinations of GPR162 modulation with inhibitors of DNA repair proteins

  • Radiation biology: Developing biological radiation modifiers based on GPR162's sensitizing effects

Intersection with Innate Immune Signaling:

The GPR162-STING connection opens avenues in immunology research:

  • Cytosolic DNA sensing: Exploring alternative activation mechanisms for STING beyond canonical cGAS-mediated pathways

  • Innate-adaptive immune interface: Investigating how GPR162-induced type I interferons shape adaptive immune responses

  • Tumor immunology: Understanding the immunological consequences of radiotherapy in the context of GPR162 expression

Applications in Single-Cell and Spatial Biology:

Emerging technologies could provide deeper insights:

  • Single-cell transcriptomics: Mapping GPR162 expression heterogeneity within tumors and normal tissues

  • Spatial proteomics: Determining subcellular localization dynamics of GPR162 during cell cycle and stress responses

  • In situ protein interaction mapping: Visualizing GPR162-STING complexes in their native cellular context

Integration with Metabolic Research:

Given GPR162's roles in glucose homeostasis:

  • Brain-periphery communication: Exploring how neural GPR162 signaling influences peripheral metabolic processes

  • Metabolic reprogramming in cancer: Investigating potential connections between GPR162 and cancer cell metabolism

  • Nutrient sensing pathways: Examining if GPR162 participates in cellular nutrient detection mechanisms

Opportunities in Drug Development Technologies:

Novel approaches for targeting GPR162:

  • Proteolysis targeting chimeras (PROTACs): Developing bifunctional molecules to induce GPR162 degradation in contexts where reduction is beneficial

  • RNA therapeutics: Using antisense oligonucleotides or siRNA to modulate GPR162 expression with tissue specificity

  • Gene editing approaches: Employing CRISPR-based technologies for precise manipulation of GPR162 expression or function

The multifaceted nature of GPR162 biology—spanning cancer, immunology, metabolism, and neuroscience—positions it at the intersection of numerous research frontiers. This creates rich opportunities for collaborative research approaches that could yield insights with both basic science significance and translational potential.

What are the most significant recent advances in GPR162 research?

The field of GPR162 research has seen several important breakthroughs in recent years, substantially expanding our understanding of this receptor's biological functions and therapeutic potential:

  • Discovery of the GPR162-STING interaction: The identification of direct interaction between GPR162 and STING represents a paradigm shift in understanding both proteins' functions. This finding established a novel, cGAS-independent mechanism for STING activation with significant implications for DNA damage response and innate immunity signaling .

  • Characterization of radiotherapy sensitization: The elucidation of GPR162's role in enhancing cancer cell sensitivity to ionizing radiation has opened new avenues for improving radiotherapy efficacy. The detailed molecular mechanisms involving DNA damage recognition, repair inhibition, and immune activation provide multiple targetable pathways .

  • Documentation of prognostic significance: Comprehensive analyses across multiple cancer types have consistently demonstrated that higher GPR162 expression correlates with better patient outcomes. This establishes GPR162 as a potential prognostic biomarker with clinical relevance .

  • Establishment of metabolic connections: The discovery that GPR162 variants are associated with glucose homeostasis impairments in humans connects this receptor to metabolic regulation, expanding its significance beyond cancer biology .

  • Mapping of neuroanatomical distribution: Detailed characterization of GPR162 expression in brain regions involved in energy balance and reward processing has provided anatomical evidence supporting its role in feeding behavior and metabolic regulation .

These advances collectively position GPR162 as a multifunctional signaling hub with relevance to cancer biology, radiation response, metabolism, and neurological function. The convergence of these diverse roles suggests GPR162 may serve as an integrator of cellular stress responses and metabolic adaptation, with particular significance in pathological contexts such as cancer.

What methodological innovations might accelerate GPR162 research in the near future?

Several emerging methodological approaches hold promise for addressing current knowledge gaps and accelerating GPR162 research:

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy: High-resolution structures of GPR162 alone and in complex with STING would provide crucial insights for drug design and understanding signaling mechanisms

  • AlphaFold and related AI approaches: Improved structural predictions could guide experimental design even before crystal structures become available

  • HDX-MS (hydrogen-deuterium exchange mass spectrometry): This technique could map conformational changes in GPR162 upon activation or interaction with partners

Functional Genomics and High-throughput Screening:

  • CRISPR activation/interference screens: Systematic identification of genes that modify GPR162 function using CRISPRa/CRISPRi libraries

  • Pooled shRNA/siRNA screens: Identifying synthetic lethal interactions with GPR162 overexpression or knockdown

  • DNA-encoded library technology: Screening vast chemical space for molecules that bind to or modulate GPR162

Advanced Imaging Approaches:

  • Live-cell fluorescence resonance energy transfer (FRET): Real-time monitoring of GPR162-STING interactions in living cells

  • Super-resolution microscopy: Nanoscale visualization of GPR162 trafficking and localization during cellular stress responses

  • Intravital microscopy: Observing GPR162-dependent processes in living tissues and tumors

Single-cell and Spatial Technologies:

  • Single-cell RNA sequencing: Profiling GPR162 expression heterogeneity in complex tissues

  • Spatial transcriptomics: Mapping GPR162 expression in tissue context with preserved spatial information

  • Multiplexed ion beam imaging (MIBI): Simultaneously visualizing multiple proteins including GPR162 at subcellular resolution

Translational Research Tools:

  • Patient-derived organoids: Testing GPR162-targeting approaches in more physiologically relevant models

  • Humanized mouse models: Evaluating GPR162 modulators in immunocompetent models with human immune components

  • Pharmacogenomic screening: Identifying drugs that synergize with GPR162 expression or activation

These methodological innovations would address current limitations in GPR162 research, particularly regarding structural information, high-throughput functional assays, and translational models. Implementing these approaches could accelerate both basic understanding of GPR162 biology and development of therapeutic applications targeting this receptor system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.