Recombinant Human Probable G-protein coupled receptor 171 (GPR171)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Recombinant GPR171 is generated using heterologous expression systems to ensure high purity and functionality:

  • Expression Systems: Common platforms include E. coli, wheat germ, and mammalian cells. For example, Creative BioMart’s GPR171-5210H variant is expressed in wheat germ without affinity tags .

  • Storage: Requires storage at -80°C in 25 mM Tris-HCl buffer (pH 8.0) with 2% glycerol to prevent aggregation .

  • Validation: Functional assays (e.g., GTPγS binding, cAMP modulation) confirm receptor activity .

Research Applications

Recombinant GPR171 serves as a critical tool in both basic and translational research:

ApplicationUse Case
Antibody DevelopmentUsed to generate polyclonal antibodies (e.g., CUSABIO’s CSB-PA002766) for Western blot and IHC .
Ligand ScreeningIdentifies agonists (e.g., BigLEN) and antagonists (e.g., MS 21570) for therapeutic targeting .
Functional StudiesElucidates roles in feeding behavior (via hypothalamic signaling), T cell suppression, and cancer metastasis .
Pain ResearchEvaluates GPR171’s analgesic potential in neuropathic and inflammatory pain models .

Key Findings from Preclinical Studies

  • Metabolic Regulation:

    • GPR171 binds BigLEN, a neuropeptide regulating feeding behavior. The C-terminal tetrapeptide (Leu-Leu-Pro-Pro) is sufficient for receptor activation .

    • Knockdown of GPR171 in mice reduces food intake by >90% under fasting conditions, highlighting its role in energy homeostasis .

  • Immune Modulation:

    • GPR171 suppresses T cell receptor signaling, limiting antitumor responses. Antagonists enhance T cell proliferation and improve checkpoint inhibitor efficacy .

  • Cancer Progression:

    • Overexpression of GPR171 correlates with lung cancer metastasis and proliferation in vitro and in vivo. It operates independently of EGFR, suggesting a novel therapeutic target .

  • Pain Pathways:

    • GPR171 agonists reduce chronic neuropathic pain in male mice, though sex-specific differences in receptor expression exist .

Clinical and Therapeutic Implications

  • Target Validation: GPR171’s dual role in metabolism and immunity positions it as a multipurpose target for obesity, cancer, and autoimmune diseases.

  • Drug Development: Synthetic ligands (e.g., MS15203) show promise in preclinical pain models but require further optimization for human trials .

Challenges and Future Directions

  • Structural Biology: No resolved 3D structures exist for GPR171, limiting rational drug design .

  • Species-Specific Effects: Murine studies dominate current data; human translational studies are needed .

  • Ligand Specificity: Off-target effects of BigLEN-derived peptides require addressing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
GPR171; H963; Probable G-protein coupled receptor 171; G-protein coupled receptor H963
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD FLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSC KIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLT NFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYH IVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF ASPKETKAQKEKLRCENNA
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. High GPR171 expression enhances proliferation and metastasis of lung cancer. PMID: 26760963
Database Links

HGNC: 30057

KEGG: hsa:29909

UniGene: Hs.549152

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.