Recombinant Human Probable G-protein coupled receptor 174 (GPR174)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human GPR174

Recombinant Human Probable G-protein coupled receptor 174 (GPR174) is a laboratory-engineered form of the GPR174 protein, a G-protein coupled receptor (GPCR) involved in immune regulation. As a member of the P2Y receptor family, GPR174 is encoded by the GPR174 gene located on chromosome Xq21.1 and is associated with modulating T-cell suppression and lymphoid tissue function . Recombinant GPR174 enables researchers to study its structure, ligand interactions, and therapeutic potential in autoimmune diseases and cancer immunotherapy.

Protein Characteristics

GPR174 is a seven-transmembrane (7TM) domain receptor with high expression in lymphoid tissues. Key structural and functional attributes include:

PropertyDetail
Gene ID84636 (Human)
UniProt IDQ9BXC1
Ligand specificityLysophosphatidylserine (LysoPS)
Signaling pathwaysGαs (cAMP production), Gα12/13
Key immunological rolesSuppression of T-cell activation, regulation of B-cell gene expression

Cryo-EM studies reveal that LysoPS binds to a pocket formed by transmembrane helices and extracellular loop 2 (ECL2), with a non-canonical Gαs coupling mode observed in its active state .

Immune Regulation

  • T-cell suppression: GPR174 activation by LysoPS inhibits T-cell proliferation and IL-2 production via Gαs-mediated cAMP elevation .

  • B-cell modulation: In vitro, GPR174 signaling upregulates Cd86, Nr4a1, and phosphodiesterases in B cells, reducing survival under unstimulated conditions .

  • Autoimmunity link: Genetic variants in GPR174 are associated with Graves’ disease and Addison’s disease .

Therapeutic Potential

  • Cancer immunotherapy: GPR174 inhibition enhances cytokine production (e.g., IFN-γ, TNF-α) in T cells, synergizing with adenosine receptor blockers to amplify anti-tumor responses .

  • Sepsis prognosis: Low GPR174 mRNA levels correlate with severe sepsis and poor survival, while Gpr174-knockout mice show reduced organ damage and inflammatory cytokines .

Challenges in Research

  1. Endogenous ligand interference: GPR174 is maximally activated by endogenous LysoPS in vitro, complicating exogenous ligand studies .

  2. Expression complexity: Purification of functional 7TM receptors requires optimized solubilization and stabilization protocols .

  3. Species-specific differences: Mouse GPR174 shares 78% amino acid identity with human GPR174, necessitating careful cross-species validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request, subject to availability.
Lead Time
Delivery times may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your preference.
Synonyms
GPR174; FKSG79; GPCR17; Probable G-protein coupled receptor 174
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC
Uniprot No.

Target Background

Function
Probable G-protein coupled receptor 174 (GPR174) is a putative receptor for purines coupled to G-proteins.
Gene References Into Functions
  1. This study investigated the association between polymorphisms in the RNASET2, GPR174, and PTPN22 genes and liver damage (LD) resulting from Graves' disease (GD) hyperthyroidism. The findings revealed that GPR174 rs3827440, PTPN22 rs3789604, and RNASET2 rs9355610 were significantly associated with altered risk of GD-derived LD. PMID: 28568286
  2. For the first time, this research demonstrated a significant association between this X chromosome-encoded immunoreceptor and autoimmune Addison's disease. PMID: 25295623
  3. This study provides the first replication in a Caucasian population of the association between Graves' disease and the GPR174 rs3827440 single nucleotide polymorphism, initially reported among Chinese. PMID: 24289805
  4. The discovery of an X-linked risk locus for Graves' disease expands our understanding of the X chromosome's role in disease susceptibility. PMID: 23667180
  5. These results suggest that GPR174 is a putative LysoPS receptor conjugating with Galpha(s). Its expression induces morphological changes in CHO cells by constitutively activating adenylyl cycles, accompanied by cell conjunctions and delayed proliferation. PMID: 23178570
Database Links

HGNC: 30245

OMIM: 300903

KEGG: hsa:84636

UniGene: Hs.326713

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR174 and what cellular systems express this receptor?

GPR174 belongs to the G protein-coupled receptor superfamily characterized by seven alpha-helical transmembrane domains. It was initially classified as an orphan receptor but is now known to respond to lysophosphatidylserine (LysoPS). The gene encoding GPR174 is located on chromosome Xq21.1 and contains 4 exons .

GPR174 is abundantly expressed in both B and T lymphocytes, making it particularly relevant for immunological research . Expression analysis reveals significant presence in thymic tissue, peripheral lymphoid organs, and regulatory T cells. When studying expression patterns, researchers should consider using flow cytometry with validated antibodies or transcript analysis via RT-qPCR to avoid cross-reactivity issues with related GPCRs.

What are the known ligands for GPR174 and their binding mechanisms?

Lysophosphatidylserine (LysoPS) has been identified as the primary ligand for GPR174. Structural studies have revealed that LysoPS binding to GPR174 involves several key interactions:

  • The phosphate group of LysoPS interacts with K98^3.32^, R75^2.60^, R156^4.64^, and K257^6.62^ in GPR174

  • The amino group of the serine in LysoPS forms a hydrogen bond with Y79^2.64^ in GPR174

  • The hydrophobic tail's orientation is determined by the arrangement of TM4 and TM5, particularly influenced by P153^4.61^ and P197^5.50^

Compared to other LysoPS receptors like GPR34, GPR174 forms more charged interactions with the polar head of LysoPS, suggesting potentially tighter binding . For experimental approaches, researchers should consider using LysoPS (18:1) as it has been successfully used in structural studies.

Through which G protein pathways does GPR174 signal and what are the downstream effects?

GPR174 signals primarily through Gαs-containing heterotrimeric G proteins, as demonstrated by multiple lines of evidence:

  • B cells lacking Gαs show a block in induction of the GPR174-dependent gene expression program

  • GPR174 signaling leads to cAMP production, which typically has anti-inflammatory effects

  • Structural studies have confirmed the formation of LysoPS-bound GPR174-Gs complexes

The downstream effects of GPR174 signaling in B cells include:

GPR174-Gαs Induced GenesGPR174-Gαs Repressed Genes
Nr4a1 (NUR77)Cd22
Cd86Btla
Ccr7
Phosphodiesterases

Importantly, GPR174-Gαs signaling reduces B cell viability in culture, suggesting a role in regulating lymphocyte survival . Researchers investigating GPR174 signaling should consider using protein kinase A inhibitors as controls, since spontaneous CD86 upregulation in cultured B cells is PKA-dependent.

How does GPR174 influence regulatory T cell biology and autoimmunity?

GPR174 plays a crucial role in constraining regulatory T cell (Treg) accumulation and activity. When studying GPR174's effects on Tregs, researchers should consider:

  • Tissue specificity: Gpr174^-/Y^ mice show increased Foxp3^+^CD4^+^ single-positive (SP) cell frequencies in the thymus and colon lamina propria, but not in spleen and lymph nodes

  • Cell-intrinsic effects: In mixed bone marrow chimeric mice, Gpr174^-/Y^ Foxp3^+^CD4^+^ SP thymocyte frequencies were significantly higher than those of Gpr174^-/Y^ DP and CD4 SP thymocytes, indicating cell-intrinsic regulation

  • Signaling mechanisms: CD25^+^CD4^+^ SP thymocytes in Gpr174^-/Y^ mice express lower levels of Nur77-GFP, suggesting altered TCR signaling during development

GPR174 deficiency leads to enhanced Treg cell proliferation, as evidenced by increased Ki-67 expression in thymic Foxp3^+^CD4^+^ SP cells but not in Foxp3^-^CD4^+^ SP thymocytes . This suggests GPR174 may intrinsically constrain thymic Treg cell proliferation.

What role does GPR174 play in B cell function and how can this be experimentally assessed?

GPR174 significantly modulates B cell gene expression and survival in a G protein-dependent manner. Key experimental findings include:

  • B cells undergo a spontaneous GPR174-dependent activation process during in vitro culture, associated with marked changes in gene expression

  • Both GPR174- and Gαs-deficient B cells show enhanced survival in culture

  • In vivo, GPR174 contributes to NUR77 expression in follicular B cells and is required for establishing a normal-sized marginal zone compartment

To experimentally assess GPR174 function in B cells, researchers can:

  • Measure expression of GPR174-dependent genes (Cd86, Nr4a1, Ccr7) after culture

  • Assess B cell viability in the presence/absence of GPR174 antagonists

  • Use lysoPS treatment in vivo to promote CD86 upregulation by follicular B cells

  • Examine marginal zone B cell development in Gpr174^-/Y^ mice

Importantly, treatment of mice with lysophosphatidylserine (lysoPS) is sufficient to promote CD86 upregulation by follicular B cells, providing a useful experimental approach to activate this pathway in vivo .

How are GPR174 variants associated with autoimmune conditions?

Variants in the GPR174 locus have been associated with multiple autoimmune diseases . Specifically:

  • The GPR174 gene has been linked to Graves' disease susceptibility through genome-wide association studies

  • The role of GPR174 in restraining T cell responses and modulating B cell function provides mechanistic insights into how alterations in GPR174 expression may contribute to autoimmunity

When studying these associations, researchers should consider that GPR174 is located on the X chromosome (Xq21.1), which may contribute to sex-based differences in autoimmune disease susceptibility. Experimental approaches should account for these potential sex differences in study design.

What methodological challenges exist in studying GPR174 function?

Several methodological challenges must be addressed when investigating GPR174:

  • In vitro B cell culture limitations: During culture without stimulation, B cells undergo massive changes in gene expression promoted by GPR174 signaling via Gαs . Researchers should consider using GPR174 antagonists to reduce this shift in gene expression and augment B cell survival during culture.

  • Ligand complexity: While LysoPS is established as a GPR174 ligand, the physiological regulation of LysoPS levels in different tissues remains poorly understood. Researchers should measure tissue LysoPS concentrations when interpreting GPR174 functions in different contexts.

  • Receptor structure considerations: When designing binding studies, researchers should account for specific interactions in the binding pocket. The polar head of LysoPS makes more charged interactions with GPR174 than with GPR34, suggesting tighter binding that may affect experimental approaches .

How can researchers effectively produce and utilize recombinant GPR174 for structural and functional studies?

Structural studies of GPR174 have been successfully conducted using cryo-electron microscopy (cryo-EM). Key methodological considerations include:

  • Use of an engineered G protein (mini-Gs) to facilitate complex formation and improve cryo-EM sample quality

  • Modeling of LysoPS (18:1) into the density, with attention to the fact that the last 6 carbons of the oleic acid often lack density

  • Comparing binding modes between related receptors (e.g., GPR34 vs. GPR174) to identify critical residues for ligand recognition

When expressing recombinant GPR174, researchers should consider:

  • Expression systems that accommodate proper folding of seven-transmembrane domain proteins

  • Addition of stabilizing mutations or fusion proteins to improve expression and stability

  • Use of detergents or nanodiscs that maintain the native structure of the receptor

What are the current gaps in our understanding of GPR174 biology?

Despite significant advances, several important questions about GPR174 remain unanswered:

  • The complete physiological role of GPR174 in different immune cell types and tissues

  • The enzymatic pathways that regulate LysoPS production and degradation in vivo

  • The potential cross-talk between GPR174 and other immunoregulatory receptors

  • The mechanisms by which GPR174 variants contribute to autoimmune disease susceptibility

Researchers approaching these questions should consider multi-disciplinary approaches combining genetic models, structural biology, and systems immunology to obtain comprehensive insights into GPR174 biology.

How might targeting GPR174 be useful in therapeutic applications?

Given GPR174's role in immune regulation, targeting this receptor may have therapeutic potential:

  • GPR174 antagonists may improve B cell survival during in vitro culture, enhancing experimental systems for studying B cell responses

  • Since GPR174 constrains regulatory T cell accumulation and activity, modulating its function might be useful in autoimmune conditions where Treg activity is insufficient

  • The anti-inflammatory effects of GPR174 signaling through Gαs (producing cAMP) suggest that GPR174 agonists might have utility in dampening excessive immune responses

When developing potential GPR174-targeting therapeutics, researchers should consider tissue specificity, potential off-target effects on related receptors, and the complex roles of GPR174 in different immune cell populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.