Recombinant Human Probable G-protein coupled receptor 25 (GPR25)

Shipped with Ice Packs
In Stock

Description

Functional Insights

GPR25 signals primarily through β-arrestin recruitment and Gi-mediated cAMP inhibition . Functional studies highlight:

  • Immune Modulation: Co-expressed with CXCL17 in mucosal tissues, suggesting roles in lymphocyte trafficking .

  • Ligand Diversity:

    LigandSpecies SpecificityEC₅₀/ActivationKey Study
    CXCL17Human~70–100 nMβ-arrestin assay
    Apelin/ApelaZebrafish, pigeoncAMP inhibitionCRE-luciferase assay

Notably, human GPR25 does not respond to Apelin/Apela peptides active in non-mammalian vertebrates .

Research Applications

Recombinant GPR25 is produced in HEK293T cells for functional assays . Key applications include:

  • β-Arrestin Recruitment Assays: NanoBiT technology quantifies ligand-induced receptor activation .

  • Pathway Analysis: CRISPR-edited cell lines (e.g., ADRB2-KO HEK293T) isolate GPR25-specific cAMP signaling .

  • Drug Discovery: High-throughput screening identifies allosteric modulators targeting extracellular receptor regions .

Disease Implications

GWAS and eQTL studies link GPR25 dysregulation to autoimmune conditions:

  • Multiple Sclerosis: Altered lymphocyte migration in airway/gastric mucosae .

  • Hypertension: Correlated with arterial stiffness phenotypes .

  • Cancer: Overexpressed in B-cell malignancies (Protein Atlas data) .

Pharmacological Profile

PropertyDetails
Expression SystemsHEK293T, CHO-K1 with tetracycline-inducible promoters
Stabilizing MutationsW95A/R178A abolish CXCL17 binding; C-terminal truncations impair signaling
Therapeutic TargetingStanford-patented methods for mucosal immune modulation

Challenges and Future Directions

Despite deorphanization progress, unresolved questions remain:

  • Endogenous ligand confirmation in human physiological contexts .

  • Structural determination of active-state GPR25-G protein complexes .

  • Tissue-specific knockout models to validate immune roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPR25; Probable G-protein coupled receptor 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFV VWLLAGRRGPRRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALA GTRCAGALLLAGMSVDRYLAVVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGL QPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPLVVTLFCYCRISRRLRRPPHVGRARR NSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCPLLLALRWGLTIATCLAFVNS CANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCRAQAANTASAS W
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. GPR-25 exhibits homology to receptors involved in blood pressure regulation. PMID: 17386346
Database Links

HGNC: 4480

OMIM: 602174

KEGG: hsa:2848

STRING: 9606.ENSP00000301917

UniGene: Hs.534316

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR25 and what are its basic structural properties?

GPR25 (G protein-coupled receptor 25) is a member of the G-protein coupled receptor 1 family. In humans, the canonical protein consists of 361 amino acid residues with a molecular mass of approximately 38.8 kDa. It localizes to the cell membrane and demonstrates the typical GPCR structure with seven transmembrane domains (TMDs), a short extracellular N-terminus, and a short intracellular C-terminus. The receptor contains conserved cysteine residues (C112 and C191) that form a critical disulfide bond tethering the extracellular loop 2 to the extracellular end of TMD2, a feature present in most GPCRs .

What is the evolutionary conservation pattern of GPR25?

GPR25 demonstrates wide evolutionary conservation across vertebrates, from fish to mammals. Sequence alignment analysis has identified several conserved residues likely responsible for structural integrity, downstream signaling mechanisms, and ligand binding capabilities. This high degree of conservation suggests GPR25 may serve important physiological functions that have been maintained throughout vertebrate evolution .

What is the expression pattern of GPR25 in human tissues?

According to the Human Protein Atlas, GPR25 shows a tissue-specific expression pattern with predominant expression in the stomach and lung tissues. At the cellular level, GPR25 is primarily expressed by immune cells, including T-cells, B-cells, plasma cells, and various other immune cell populations. This expression pattern suggests GPR25 may play significant roles in immune system function and regulation .

What are the recommended methods for detecting GPR25 expression in tissue samples?

For detecting GPR25 expression in tissue samples, Western Blot and immunohistochemistry are among the most commonly employed techniques. Immunohistochemistry-paraffin (IHC-p) can be particularly useful for visualizing GPR25 localization within fixed tissue sections. For more sensitive detection, researchers may also employ ELISA-based methods. When selecting antibodies, consider polyclonal antibodies targeting the C-terminal or middle regions of GPR25, as these regions contain important epitopes. Multiple vendors offer antibodies with reactivity to human, mouse, and rat GPR25, allowing for cross-species studies .

How should I design experiments to study GPR25 activation?

To study GPR25 activation, the β-arrestin recruitment assay has proven effective. This approach involves transfecting human embryonic kidney (HEK) 293T cells with GPR25 expression constructs and measuring receptor activation upon ligand application. For testing potential ligands such as CXCL17, establish a dose-response curve using varying concentrations to determine EC50 values. Include appropriate negative controls by testing the putative ligand against other GPCRs to confirm specificity. For robust experimental design, compare wild-type receptor responses with those of mutated receptors (particularly at conserved residues like W95 and R178) to validate structure-function relationships .

What are the appropriate cell models for studying GPR25 function?

HEK293T cells represent a well-established heterologous expression system for studying GPR25 function. These cells provide a clean background for transfection studies and are particularly useful for signaling assays. For physiologically relevant models, consider cell types with natural GPR25 expression, including T-cells, B-cells, and other immune cell populations. Primary cells isolated from lung or stomach tissues may also serve as valuable models, as these tissues demonstrate significant GPR25 expression. Always validate GPR25 expression in your chosen model using Western blot or RT-PCR before conducting functional studies .

How can site-directed mutagenesis be used to study GPR25 structure-function relationships?

Site-directed mutagenesis provides a powerful approach for investigating structure-function relationships in GPR25. Based on recent research, conserved residues W95 and R178 appear critical for ligand interaction. When designing mutagenesis experiments, prioritize alanine substitutions of these and other conserved residues in the predicted orthosteric ligand binding pocket. Following mutagenesis, assess functional consequences through β-arrestin recruitment assays or other activation readouts using known ligands such as CXCL17. Compare EC50 values and maximum responses between wild-type and mutant receptors to quantify the impact of specific residues on receptor function. Additionally, consider creating chimeric receptors with related GPCRs to identify domains responsible for ligand specificity .

What approaches can be used to identify and validate GPR25 ligands?

To identify potential GPR25 ligands, employ a multi-faceted approach combining in silico prediction with experimental validation. Begin with computational methods such as AlphaFold-based structural modeling to predict potential ligand-receptor interactions. For experimental validation, use functional assays such as β-arrestin recruitment in GPR25-transfected cells, testing candidate ligands at concentrations ranging from 1 nM to 10 μM. CXCL17 has recently been identified as an activator of GPR25 with an EC50 value around 100 nM. When validating ligand specificity, assess activation across multiple GPCRs (at least 15-20 related receptors) to confirm selective binding. Structure-activity relationship studies, such as testing truncated or mutated ligands (like CXCL17 with deleted C-terminal residues), can provide insight into critical binding determinants .

How can I investigate signaling pathways downstream of GPR25?

Investigating GPR25 signaling pathways requires systematic analysis of G-protein coupling preferences and second messenger responses. Employ BRET-based G-protein activation assays to determine which G-protein subtypes (Gαs, Gαi/o, Gαq/11, Gα12/13) couple to GPR25 upon ligand stimulation. Follow this with appropriate second messenger assays, such as cAMP accumulation for Gαs/Gαi/o coupling or calcium mobilization for Gαq/11 coupling. To map complete signaling networks, use phosphoproteomic approaches comparing stimulated versus unstimulated conditions in GPR25-expressing cells. RNA-seq analysis can identify transcriptional changes following receptor activation, providing insight into longer-term signaling outcomes. For pathway validation, employ selective inhibitors targeting specific nodes in identified pathways and assess their impact on GPR25-mediated cellular responses .

What is known about CXCL17 as a ligand for GPR25?

Recent research has identified CXCL17 as an activator of the orphan receptor GPR25. In β-arrestin recruitment assays, recombinant human CXCL17 activates human GPR25 in transfected HEK293T cells with an EC50 value of approximately 100 nM. Importantly, CXCL17 demonstrates specificity for GPR25, showing no activation effect on 17 other tested G protein-coupled receptors. Structure-function studies reveal that the C-terminal region of CXCL17 is critical for receptor activation, as deletion of three conserved C-terminal residues almost completely abolishes its activity. The interaction appears consistent with AlphaFold 3-predicted binding models, where the highly conserved C-terminal fragment of CXCL17 inserts into the orthosteric ligand binding pocket of GPR25 .

What structural features of GPR25 are important for ligand binding?

Key structural features of GPR25 important for ligand binding include the orthosteric ligand binding pocket formed by the transmembrane domains. Specific residues that appear critical for ligand interaction include W95 and R178, as alanine substitutions at these positions almost abolish the receptor's response to CXCL17. According to AlphaFold 3-predicted structures, W95 likely forms hydrophobic interactions with the conserved P118 of human CXCL17, while the positively charged R178 likely forms hydrogen bonds with the carboxyl oxygen of L117 of the ligand. The disulfide bond between conserved C112 and C191, tethering the extracellular loop 2 to TMD2, may also play an important structural role in maintaining the receptor conformation necessary for ligand binding .

How can GPR25-ligand interactions be modeled computationally?

Computational modeling of GPR25-ligand interactions can be approached using advanced structural prediction tools such as AlphaFold 3. Begin by generating high-confidence structural models of both GPR25 and potential ligands (like CXCL17). Use protein-protein docking algorithms specifically optimized for GPCR-ligand interactions to predict binding poses. Evaluate model quality through metrics such as ipTM values, with values between 0.6-0.7 suggesting reasonable confidence in the predicted interaction. For CXCL17-GPR25 interactions, focus particular attention on the C-terminal region of CXCL17 and its insertion into the orthosteric binding pocket of GPR25. Following initial modeling, employ molecular dynamics simulations (50-100 ns) to assess the stability of predicted interactions and identify additional contact points. Finally, validate computational predictions through site-directed mutagenesis experiments targeting key interaction residues identified in the model .

What are the potential physiological roles of GPR25 based on its expression pattern?

Based on its expression pattern, GPR25 likely plays important roles in immune system function. Its predominant expression in T-cells, B-cells, plasma cells, and other immune cell populations suggests involvement in immune regulation, potentially influencing lymphocyte activation, differentiation, or migration. The significant expression in stomach and lung tissues may indicate tissue-specific functions, possibly related to mucosal immunity or response to environmental challenges. Additionally, the identification of CXCL17 as a potential ligand further supports immunoregulatory functions, as chemokines typically mediate immune cell recruitment and activation. Further research is needed to definitively establish the precise physiological roles of GPR25 in different tissues and cell types .

How might GPR25 contribute to disease processes?

Given its expression in immune cells, GPR25 may contribute to various immunological disorders, including inflammatory diseases, autoimmune conditions, and potentially cancer immunosurveillance. Previous studies have suggested associations between GPR25 and regulation of blood pressure, indicating potential roles in cardiovascular pathologies. Additionally, research has linked GPR25 to the expression of PD-1/PD-L1, suggesting possible involvement in immune checkpoint regulation relevant to cancer immunotherapy. As an orphan receptor recently paired with CXCL17, GPR25 represents an understudied potential drug target for modulating immune responses in various disease contexts. Systematic studies correlating GPR25 expression or genetic variants with disease phenotypes would help clarify its pathological relevance .

What are common challenges in producing recombinant GPR25 for structural studies?

Producing recombinant GPR25 for structural studies presents several challenges common to membrane proteins. As a seven-transmembrane domain protein, GPR25 is highly hydrophobic and may demonstrate poor expression, misfolding, or aggregation in recombinant systems. To overcome these challenges, consider using specialized expression systems optimized for membrane proteins, such as insect cells (Sf9, Hi5) or mammalian cells rather than bacterial systems. For enhanced expression and proper folding, employ fusion partners such as maltose-binding protein or thermostabilized apocytochrome b562RIL (BRIL). Extraction from membranes requires careful optimization of detergent conditions; initial screening should include mild detergents like DDM, LMNG, or GDN. For structural studies, consider lipid nanodisc reconstitution to maintain a native-like membrane environment. If crystallography is the goal, explore thermostabilizing mutations to enhance conformational homogeneity .

How can I troubleshoot low signal-to-noise ratios in GPR25 detection experiments?

Low signal-to-noise ratios in GPR25 detection experiments may stem from several factors. First, verify antibody specificity using positive and negative controls, including GPR25-overexpressing cells and knockout/knockdown samples. If using Western blot, optimize protein extraction protocols specifically for membrane proteins, ensuring complete solubilization with appropriate detergents (0.5-1% Triton X-100 or NP-40). For immunohistochemistry, test different antigen retrieval methods, as GPR25 epitopes may be sensitive to fixation conditions. Consider signal amplification strategies such as tyramide signal amplification or polymer-based detection systems. If expression levels are naturally low, concentrate samples through immunoprecipitation before detection. For functional studies measuring GPR25 activation, optimize transfection efficiency and ensure adequate expression levels through fluorescent tagging and microscopy validation. Finally, reduce background by implementing more stringent washing conditions and using blocking reagents specifically designed to minimize non-specific binding .

What are the most significant recent advances in GPR25 research?

The most significant recent advance in GPR25 research is the identification of CXCL17 as a potential endogenous ligand. This discovery, reported in a 2024 preprint, represents a major breakthrough in understanding this previously orphan receptor. The study demonstrated that recombinant human CXCL17 activates human GPR25 in transfected cells with an EC50 value around 100 nM and showed specificity by testing against 17 other GPCRs. The interaction was further validated through mutational analysis of both the receptor (W95A and R178A mutations) and ligand (C-terminal deletions), consistent with computational binding models. This de-orphanization of GPR25 opens numerous new research directions, potentially explaining the previously reported associations of GPR25 with blood pressure regulation and PD-1/PD-L1 expression. These findings significantly advance our understanding of GPR25 biology and provide a foundation for more detailed functional studies .

What are the most promising future research directions for GPR25?

Future GPR25 research should focus on several promising directions. First, detailed characterization of GPR25 signaling pathways following CXCL17 activation will provide insight into its cellular functions. Analysis of G-protein coupling specificity and downstream effectors will be particularly important. Second, development of selective small-molecule modulators (both agonists and antagonists) will provide valuable tools for in vitro and in vivo studies. Third, investigation of GPR25 function in immune cell populations should address its potential roles in immune cell activation, differentiation, and migration. Fourth, generation and characterization of GPR25 knockout models would help define its physiological significance. Fifth, exploration of potential associations between GPR25 genetic variants and human diseases may reveal new therapeutic opportunities. Finally, high-resolution structural studies of GPR25 alone and in complex with CXCL17 would provide valuable insights for structure-based drug design targeting this receptor .

What methodological advances would most benefit GPR25 research?

Several methodological advances would significantly benefit GPR25 research. Development of highly selective monoclonal antibodies against different epitopes of GPR25 would improve detection specificity and enable better characterization of expression patterns. Creation of fluorescent or bioluminescent biosensors for real-time monitoring of GPR25 activation in living cells would facilitate high-throughput screening approaches. Implementation of CRISPR-Cas9-based genome editing to introduce endogenous tags or reporter systems would allow study of GPR25 in physiologically relevant contexts. Application of single-cell technologies to analyze GPR25 expression and signaling at higher resolution across immune cell populations would reveal cell-specific functions. Finally, development of selective small-molecule probes with appropriate pharmacokinetic properties would enable in vivo studies of GPR25 function in normal physiology and disease models .

What expression systems are most suitable for producing recombinant GPR25?

For producing recombinant GPR25, mammalian expression systems generally yield the most functionally relevant protein. HEK293T cells have proven effective for functional studies, as demonstrated in CXCL17 activation experiments. For larger-scale production, consider stable cell lines using HEK293S GnTI- cells (lacking complex N-glycans) or ExpiCHO cells for enhanced yields. Insect cell systems (Sf9 or Hi5) using baculovirus expression vectors present an alternative with potentially higher expression levels, though post-translational modifications differ from mammalian cells. For structural studies requiring significant quantities of purified receptor, add affinity tags (His6, FLAG, or STREP) and consider fusion partners that enhance folding and stability. If attempting bacterial expression (typically challenging for full-length GPCRs), focus on expressing specific domains rather than the entire receptor, or employ specialized strains engineered for membrane protein expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.