Recombinant Human Probable G-protein coupled receptor 33 (GPR33)

Shipped with Ice Packs
In Stock

Description

Production and Purification Strategies

Creative Biolabs' Magic™ platform enables high-yield production through:

  1. Codon optimization for heterologous expression

  2. Membrane protein stabilization using nanodisc technology

  3. Affinity chromatography with tag-specific resins

Key challenges addressed:

  • Overcoming low natural expression in human tissues

  • Maintaining structural integrity of transmembrane domains

  • Achieving proper post-translational modifications in plant systems

Signaling Pathway Activation

Optogenetic studies demonstrate resurrected GPR33 activates:

  • Calcium flux (Ca²⁺)

  • cAMP modulation

  • MAPK/ERK phosphorylation

  • Rho-dependent pathways

Immunological Relevance

Despite being a pseudogene, recombinant GPR33 shows:

  • Upregulation in dendritic cells under TLR stimulation

  • NF-κB/AP-1-mediated transcriptional regulation

  • Potential ancestral role in pathogen defense mechanisms

Research Applications

Key experimental uses:

  1. Ligand discovery through β-arrestin recruitment assays

  2. Pathogen entry mechanism studies (e.g., viral/bacterial interactions)

  3. Constitutive activity analysis using BRET/FRET systems

  4. Structural studies of pseudogene reactivation

Recent breakthroughs:

  • Optical resurrection via ChR2-GPR33 chimeras enabled real-time signaling analysis

  • Machine learning predictions identified potential cleavage variants as ligands

Technical Limitations and Solutions

ChallengeMitigation Strategy
Lack of endogenous ligandUse constitutive activity mutants
Low expression yieldsCodon optimization
Signal pathway ambiguityMultiplex reporter assays

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR33; Probable G-protein coupled receptor 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQ NNYAVSTNWESKEMQASRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT
Uniprot No.

Target Background

Function
Orphan receptor; may act as a chemoattractant receptor.
Gene References Into Functions
  1. These data highlight the significant role of GPR33 in innate immunity, which became dispensable during human evolution likely due to past or balancing selection. PMID: 20399748
  2. Cloning and analysis of over 120 mammalian GPR33 orthologs from 16 of 18 eutherian orders revealed inactivation of this chemoattractant GPCR not only in humans but also in several great ape and rodent species. PMID: 15987686
Database Links

HGNC: 4489

OMIM: 610118

KEGG: hsa:2856

UniGene: Hs.727479

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen, lung, heart, liver, kidney, pancreas, thymus, gonads and leukocytes.

Q&A

What is GPR33 and what is its classification in the GPCR family?

GPR33 is classified as an orphan G-protein coupled receptor within the Class A (Rhodopsin) family. It belongs to the chemoattractant receptor subfamily and is considered a member of the chemokine-like receptor group. The receptor evolved in mammals approximately 125-190 million years ago and has been identified across multiple mammalian orders . GPR33 contains the characteristic seven-transmembrane domain structure typical of GPCRs, with the human receptor sequence comprising 333 amino acids when expressed as an intact protein .

Structurally, GPR33 contains the evolutionarily conserved DRY motif (Asp-Arg-Tyr) in the C-terminal region of its third transmembrane domain, which is critical for G-protein coupling and signal transduction in rhodopsin-like GPCRs. This motif represents a key functional element that, when mutated naturally, can significantly impact receptor function .

What is the current understanding of GPR33's functional status in humans?

GPR33 exists predominantly as a pseudogene in the human population due to a premature stop codon that terminates the open reading frame after the third transmembrane domain. This results in a truncated protein that cannot function as a complete receptor . The inactivation occurred relatively recently in evolutionary terms, estimated within the past 1 million years, and appears to have undergone selection rather than resulting from neutral drift .

Despite its pseudogene status, GPR33 mRNA remains detectable in various human tissues, suggesting potential regulatory roles beyond canonical receptor signaling. Population genetics studies have revealed significant differences in GPR33 allele frequencies across human populations. The derived null-allele (pseudogene version) is nearly fixed in European populations, while both the functional and pseudogene variants persist in African and Asian populations .

Recent research has resurrected the signaling function of human GPR33 through experimental approaches, supporting hypotheses about its potential role as a pathogen entry site .

What is known about GPR33 expression patterns in immune cells?

Expression analysis has demonstrated that GPR33 is highly expressed in dendritic cells (DCs), which are pivotal in orchestrating immune responses . This expression pattern strongly supports a functional role for GPR33 in innate immunity, consistent with its classification as a chemoattractant receptor.

In murine models, GPR33 expression is regulated by toll-like receptor (TLR) activity and AP-1/NF-κB signaling pathways both in cell culture and in vivo conditions . This regulatory pattern is characteristic of immune-related genes that respond to pathogen recognition and subsequent inflammatory signaling cascades.

The dendritic cell-specific expression pattern of GPR33 provides important insights into its potential physiological functions in antigen presentation and immune cell activation, particularly in the context of pathogen recognition and response.

How does the evolutionary pattern of GPR33 pseudogenization inform our understanding of host-pathogen interactions?

The pattern of independent pseudogenization of GPR33 across multiple unrelated mammalian species (humans, other hominoids, rats, and gerbils) within a relatively short evolutionary timeframe (approximately 1 million years) strongly suggests selection pressure rather than random genetic drift . This convergent evolutionary pattern is particularly intriguing because it occurred in species that share ecological niches and potential exposure to common pathogens.

The coincidental inactivation in both rodents and primates points to a selective advantage conferred by GPR33 inactivation, potentially as a defense mechanism against pathogen entry. Rats and gerbils frequently serve as hosts for zoonotic pathogens such as hantaviruses and Yersinia pestis, respectively, and share habitats with humans . This ecological relationship strengthens the hypothesis that GPR33 may have served as an entry point for a rodent-hominoid-specific pathogen.

Population genetic analyses of GPR33 allele frequencies reveal near-fixation of the null allele in European populations compared to more varied frequencies in African and Asian populations. This geographic distribution pattern may reflect differential selective pressures related to pathogen exposure across different human populations .

What approaches can be used to study the signaling capabilities of a pseudogenized receptor like GPR33?

Studying pseudogenized receptors presents unique challenges that require innovative experimental approaches. One effective strategy employed with GPR33 involves creating chimeric receptors that combine the signaling domains of GPR33 with the light-sensing domain of rhodopsin . This technique, sometimes called "optogenetics," allows researchers to bypass the need for identifying the natural ligand of orphan receptors.

When these engineered chimeric receptors were stimulated with visible light, researchers identified activation of multiple canonical cell signaling pathways downstream of GPR33, including:

  • cAMP-dependent signaling

  • Ca²⁺-dependent pathways

  • MAPK/ERK-dependent pathways

  • Rho-dependent pathways

This approach successfully "resurrected" the signaling function of human GPR33 pseudogene, providing experimental support for its hypothesized role as a pathogen entry site. For researchers investigating pseudogenized receptors, this represents a valuable methodology to uncover functional capabilities that would otherwise remain undetectable .

Alternative approaches include genetic reconstruction of the ancestral, functional receptor sequence through site-directed mutagenesis to restore the open reading frame, followed by expression in heterologous cell systems for functional characterization.

What is the significance of DRY motif variations in GPR33 across mammalian species?

The DRY motif (Asp-Arg-Tyr) represents a highly conserved sequence in rhodopsin-like GPCRs that is critical for G-protein coupling and signal transduction. Analysis of over 100 mammalian orthologs of GPR33 revealed several polymorphic and fixed sequence variations within this motif, providing valuable insights into receptor evolution and function .

The functional consequences of these DRY variations exhibit surprising species-specificity:

SpeciesDRY VariantFunctional Consequence
MouseDHY (Arg→His)Fully functional; equivalent to wild-type
HamsterDGY (Arg→Gly)Inactivates receptor; contributed to pseudogenization
HumanDRY (wild-type)When intact, presumed functional

The naturally occurring Arg(3.50) to His mutation in mouse GPR33 unexpectedly showed no difference from the wild-type receptor in functional tests. This finding was further supported by the polymorphic existence of both Arg(3.50) and His(3.50) alleles in wild-trapped Asian house mouse populations .

In contrast, the Arg(3.50) to Gly mutation found in hamster GPR33 completely inactivates the receptor and likely contributed to pseudogenization in this species . These findings reveal that DRY motif mutations can have different receptor-specific and context-dependent consequences, challenging the conventional understanding that all DRY mutations abolish receptor function.

How can researchers investigate potential ligands for orphan receptors like GPR33?

Identifying ligands for orphan GPCRs represents one of the most significant challenges in GPCR research. For GPR33, which additionally faces complications due to its pseudogenized status in humans, several methodological approaches can be employed:

  • Phylogenetic-based ligand prediction: Analyzing the evolutionary relationships between GPR33 and receptors with known ligands can provide clues about potential ligand classes. Given GPR33's classification as a chemoattractant receptor, researchers should focus screening efforts on chemokines and related molecules.

  • Reverse pharmacology approaches: This involves expressing the receptor (either reconstructed human GPR33 or intact versions from other species) in cell lines equipped with appropriate reporter systems, then screening compound libraries or tissue/cell extracts for activation signals.

  • Bioinformatics prediction: Computational methods including machine learning algorithms trained on known GPCR-ligand pairs can predict potential ligand classes based on receptor sequence and structural features.

  • Transcriptional profiling: Analyzing gene expression changes in cells expressing functional GPR33 can provide indirect evidence of signaling pathways and potential ligand classes.

  • Chimeric receptor approach: As demonstrated successfully with GPR33, creating chimeric receptors with rhodopsin allows for optical control of receptor activation, enabling the study of downstream signaling independent of ligand identification .

For GPR33 specifically, focusing on molecules involved in pathogen recognition and immune signaling would be advisable given its expression in dendritic cells and potential role in pathogen interactions .

What expression systems are most appropriate for studying recombinant GPR33?

When designing expression systems for recombinant GPR33, researchers must consider several factors:

  • Source sequence selection: Given GPR33's pseudogene status in humans, researchers must decide whether to:

    • Reconstruct the human GPR33 by reverting the premature stop codon

    • Use intact GPR33 sequences from species where it remains functional

    • Create chimeric constructs combining domains from different species

  • Expression system options:

    • HEK293 cells: Widely used for GPCR expression due to their human origin and efficient transfection

    • CHO cells: Offer low background GPCR signaling and stable expression

    • Sf9 insect cells: Useful for higher protein yields when using baculovirus expression systems

    • Yeast expression systems: Can be advantageous for functional studies due to their simple GPCR signaling machinery

  • Tag considerations: Adding epitope tags (HA, FLAG, His) or fluorescent protein fusions (GFP, mCherry) can facilitate detection and purification but may affect receptor function and requires careful validation.

  • Inducible expression systems: Given potential toxicity issues with overexpression of GPCRs, tetracycline-inducible or similar systems allow controlled expression levels.

For GPR33 specifically, researchers should consider using immune cell lines (such as dendritic cell models) as expression systems to better reflect the native cellular environment, as GPR33 has demonstrated high expression in these cell types .

How can researchers distinguish between pseudogenized and functional GPR33 alleles in population studies?

Distinguishing between pseudogenized and functional GPR33 alleles in population studies requires precise genotyping approaches. The critical polymorphism in human GPR33 is the SNP rs17097921 (c.418T>C), which represents the difference between the TGA (stop codon/pseudogene) and CGA (arginine/intact gene) variants .

Methodological approaches include:

  • TaqMan® allelic discrimination assay: This method was successfully employed in previous studies to genotype large population cohorts for the GPR33 polymorphism . The assay uses fluorescent probes specific to each allele variant, allowing high-throughput screening.

  • RFLP (Restriction Fragment Length Polymorphism): If the polymorphism creates or destroys a restriction enzyme recognition site, RFLP can provide a cost-effective genotyping method.

  • Direct sequencing: For smaller sample sizes or when additional variations need to be identified, direct Sanger sequencing of the GPR33 locus provides comprehensive genetic information.

  • High-resolution melting analysis: This method detects sequence variations based on the melting behavior of double-stranded DNA and can be useful for rapid screening.

  • Next-generation sequencing approaches: For broader population studies, including GPR33 in targeted sequencing panels can provide information on both common and rare variants.

When designing population genetic studies of GPR33, researchers should consider including diverse ethnic groups to capture the significant differences in allele frequencies observed between European, African, and Asian populations .

What functional assays can determine GPR33 activation and signaling in experimental settings?

Despite its orphan status, several functional assays can be employed to investigate GPR33 activation and downstream signaling:

  • cAMP accumulation assays: Using ELISA, radioimmunoassay, or FRET-based sensors to measure changes in intracellular cAMP levels following receptor activation or constitutive activity.

  • Calcium mobilization assays: Fluorescent calcium indicators (Fura-2, Fluo-4) can detect intracellular calcium release triggered by GPR33 activation through Gq-coupling.

  • MAPK/ERK phosphorylation: Western blotting or ELISA-based detection of ERK1/2 phosphorylation can indicate activation of this pathway downstream of GPR33.

  • Rho activation assays: Pull-down assays using GST-rhotekin binding domain can detect activated Rho following receptor stimulation.

  • β-arrestin recruitment: BRET or FRET-based assays measuring the recruitment of fluorescently-tagged β-arrestin to the receptor can indicate receptor activation independent of G-protein signaling.

  • Reporter gene assays: Cells transfected with response elements (CRE, SRE, NFAT-RE) linked to luciferase can provide amplified readouts of downstream signaling pathway activation.

  • Optical approaches: For optogenetically-engineered GPR33 chimeras, light-induced activation followed by measurement of any of the above parameters provides controlled activation conditions .

When designing these assays, researchers should include appropriate positive controls (receptors with known signaling properties) and negative controls (mock-transfected cells or inactive receptor mutants) to validate assay performance and specificity.

How should researchers interpret the evolutionary significance of GPR33 pseudogenization across multiple species?

The independent pseudogenization of GPR33 in multiple mammalian lineages presents a fascinating evolutionary puzzle that requires careful interpretation:

  • Convergent evolution perspective: The independent inactivation of GPR33 in humans, other great apes, and several rodent species within a relatively short evolutionary timeframe (~1 million years) strongly suggests selective pressure rather than random genetic drift . Researchers should consider this as potential evidence of convergent evolution in response to a common selective pressure.

  • Pathogen interaction hypothesis: The coincidental inactivation in species that share ecological niches (humans and rodents) supports the hypothesis that GPR33 may have served as an entry point for pathogens . When interpreting this pattern, researchers should consider:

    • Historical zoonotic disease transmissions between rodents and humans

    • Geographic distribution of intact versus pseudogenized alleles in relation to historical pathogen exposures

    • Temporal correlation between estimated pseudogenization events and historical disease outbreaks

  • Functional redundancy considerations: Alternative explanations include the possibility that GPR33 function became redundant due to the evolution of other receptors with overlapping functions. Researchers should examine related chemoattractant receptors for evidence of functional compensation.

  • Balancing selection interpretation: The persistence of both functional and pseudogenized alleles in some populations suggests potential balancing selection, where heterozygotes might have had selective advantages in certain environmental contexts .

When formulating research questions about GPR33 evolution, investigators should integrate population genetics, molecular evolution, and immunological perspectives to develop comprehensive interpretations of these patterns.

What are the challenges in developing validated antibodies for GPR33 research?

Developing reliable antibodies for GPR33 research presents several significant challenges:

  • Pseudogene status: Since GPR33 is a pseudogene in most humans, native protein expression is absent or truncated, making it difficult to validate antibodies against endogenous protein.

  • Sequence conservation concerns: When using animal models with intact GPR33, researchers must consider sequence differences between species that may affect antibody cross-reactivity.

  • GPCR-specific challenges:

    • Low natural expression levels typical of GPCRs

    • Conformational epitopes that may not be preserved in denatured samples for Western blotting

    • Multiple post-translational modifications that can affect antibody recognition

    • Hydrophobic transmembrane regions that may be poorly immunogenic

  • Validation approaches for GPR33 antibodies:

    • Positive controls: Overexpression systems with tagged versions of reconstructed GPR33

    • Negative controls: Tissues/cells from species with confirmed GPR33 pseudogenization

    • Epitope mapping: Focusing on unique extracellular regions for increased specificity

    • Multiple detection methods: Confirming specificity across Western blotting, immunohistochemistry, and flow cytometry

  • Alternative detection strategies:

    • Epitope tagging of recombinant GPR33 (FLAG, HA, His)

    • Generation of fluorescent protein fusions for live-cell imaging

    • RNA detection methods (in situ hybridization, qPCR) to circumvent protein detection issues

Researchers should consider employing multiple complementary detection methods and rigorous validation protocols when developing or selecting antibodies for GPR33 studies.

How does the absence of known ligands impact experimental design for GPR33 research?

The orphan status of GPR33 (lack of identified endogenous ligands) creates significant experimental challenges that require creative approaches:

  • Alternative activation strategies:

    • Chimeric receptor approach: Engineering GPR33 with domains from receptors with known ligands or light-sensitive domains can provide controlled activation mechanisms .

    • Constitutively active mutants: Creating mutations that induce ligand-independent activation can help study downstream signaling pathways.

  • Ligand identification approaches:

    • Bioinformatic prediction: Computational approaches based on receptor sequence similarity with non-orphan GPCRs.

    • Unbiased screening: Testing tissue extracts, bodily fluids, or compound libraries in functional assays.

    • Candidate testing: Based on GPR33's expression in dendritic cells, prioritizing immune mediators and pathogen-associated molecular patterns for screening.

  • Experimental design considerations:

    • Include receptor variants from multiple species with intact GPR33 genes.

    • Incorporate positive controls (non-orphan GPCRs) in experimental systems.

    • Implement multiple assay readouts to capture diverse signaling pathways.

    • Consider both G-protein-dependent and independent signaling mechanisms.

  • Phenotypic approaches:

    • Gene knockout studies: Creating GPR33 knockout models in species with functional genes.

    • Overexpression studies: Examining phenotypic consequences of GPR33 overexpression in immune cells.

    • Comparative studies: Analyzing functional differences between species with intact versus pseudogenized GPR33.

When designing GPR33 research without known ligands, investigators should focus on connecting receptor expression patterns with potential physiological roles, particularly in immune response and pathogen interactions, based on its dendritic cell expression profile .

How might GPR33 research inform our understanding of host-pathogen evolution and zoonotic disease?

GPR33 research provides a unique window into host-pathogen coevolution, particularly regarding zoonotic disease transmission between rodents and humans:

  • Evolutionary timing insights: The timing of GPR33 pseudogenization (within the last 1 million years in humans) coincides with significant changes in human-rodent interactions through agricultural development and increased population density . This temporal correlation may provide clues about specific historical pathogens that exploited GPR33.

  • Geographic distribution patterns: The near-fixation of the null-allele in European populations compared to more variable frequencies in African and Asian populations suggests potential region-specific pathogen pressures . Researchers can investigate historical disease patterns that correlate with these population genetics findings.

  • Contemporary relevance: Identifying whether extant pathogens can exploit functional GPR33 could have implications for:

    • Susceptibility differences in individuals with intact versus pseudogenized alleles

    • Risk assessment for emerging zoonotic diseases from rodent reservoirs

    • Potential therapeutic targets for pathogen entry inhibition

  • Research approaches:

    • Screening pathogens known to transmit between rodents and humans for GPR33 interaction

    • Comparing infection outcomes in cells expressing functional versus pseudogenized GPR33

    • Population-level analyses correlating GPR33 allele status with historical disease resistance patterns

GPR33 research exemplifies how studying pseudogenized receptors can provide unexpected insights into evolutionary adaptations to infectious disease, potentially informing modern approaches to zoonotic disease prevention and management.

What can we learn from GPR33 about the functional significance of GPCR pseudogenization?

GPR33 provides an excellent model system for understanding broader patterns and consequences of GPCR pseudogenization:

  • Selective pseudogenization: Unlike many pseudogenes that result from random mutations and drift, GPR33 shows evidence of selection for the null allele . This pattern suggests that GPCR inactivation can sometimes be adaptive rather than deleterious.

  • Persistence of mRNA expression: Despite protein truncation, GPR33 mRNA remains detectable in various human tissues . Researchers can investigate whether this persistent transcription serves regulatory functions, perhaps through:

    • Competing endogenous RNA mechanisms

    • Production of bioactive peptides from truncated transcripts

    • Regulatory effects on related GPCR expression

  • Comparative analysis opportunities: The varying functional status of GPR33 across mammals allows for natural comparative studies of:

    • Immune system differences between species with functional versus pseudogenized GPR33

    • Compensatory mechanisms in species that have lost GPR33 function

    • Potential fitness trade-offs associated with GPR33 inactivation

  • Pseudogenization as a "first step": GPR33 has been described as illustrating how missense mutations can serve as a first step in the pseudogenization process . This provides insights into the evolutionary trajectories of GPCRs and how seemingly minor sequence changes can have significant functional consequences.

The study of GPR33 challenges simplistic views of pseudogenes as non-functional "genomic fossils" and highlights how receptor inactivation can represent adaptive responses to changing environmental pressures, particularly in immune-related genes.

What techniques can resurrect functional GPR33 for research purposes?

Researchers have successfully employed several techniques to resurrect functional GPR33 for experimental studies:

  • Site-directed mutagenesis: Reversing the premature stop codon in human GPR33 can restore the full-length reading frame. This approach requires:

    • Precise identification of the inactivating mutation (TGA stop codon in humans)

    • PCR-based or oligonucleotide-directed mutagenesis to revert to the ancestral sequence

    • Confirmation of full-length protein expression following transfection

  • Chimeric receptor approach: Creating fusion proteins that combine:

    • Signaling domains from GPR33 (intracellular loops and C-terminus)

    • Ligand-binding or sensory domains from well-characterized receptors

    This approach has been successfully demonstrated with GPR33 chimeras containing the light-sensing domain of rhodopsin, enabling optical control of receptor activation .

  • Species ortholog expression: Cloning and expressing intact GPR33 from species where it remains functional, such as:

    • Non-human primates with intact alleles

    • Mammalian species outside the lineages where pseudogenization occurred

    • Ancestral sequence reconstruction based on comparative genomics

  • Codon optimization and expression enhancement:

    • Adjusting codon usage for optimal expression in experimental systems

    • Including chaperon-assisting sequences to improve membrane trafficking

    • Adding stabilizing mutations identified in other GPCRs to enhance functional expression

These resurrection approaches have revealed that GPR33, when functionally expressed, can activate multiple signaling pathways including cAMP-, Ca²⁺-, MAPK/ERK-, and Rho-dependent pathways , providing important insights into its physiological role before pseudogenization.

How might understanding GPR33 contribute to broader immunological research?

GPR33 research has significant potential to advance several areas of immunological research:

  • Dendritic cell biology: The high expression of GPR33 in dendritic cells suggests a specific role in these critical antigen-presenting cells . Future research could elucidate:

    • How GPR33 signaling affects dendritic cell maturation and function

    • Potential roles in migration, cytokine production, or T-cell activation

    • Compensatory mechanisms in species with pseudogenized GPR33

  • Evolution of immune evasion: The pattern of GPR33 pseudogenization suggests adaptation against pathogen exploitation. This provides a model for studying:

    • Molecular mechanisms of pathogen entry through GPCRs

    • Evolutionary trade-offs between receptor function and pathogen resistance

    • Comparative susceptibility between species with different GPR33 statuses

  • Innate immunity signaling networks: GPR33 expression is regulated by toll-like receptors and AP-1/NF-κB signaling pathways , positioning it within critical innate immune signaling networks. This relationship could inform research on:

    • Coordination between pattern recognition and chemotactic responses

    • Integration of different innate immune signaling pathways

    • Species-specific differences in innate immune regulation

  • Translational implications: Despite being predominantly pseudogenized in humans, understanding ancestral GPR33 function could inform:

    • Development of synthetic receptors for immunotherapy

    • Identification of related receptors that assumed GPR33 functions

    • Novel approaches to modulating immune cell trafficking and activation

By viewing GPR33 through the lens of both its ancestral function and evolutionary inactivation, researchers can gain unique insights into immune system adaptation and host-pathogen coevolution.

What are the key methodological considerations for researchers beginning work with GPR33?

Researchers initiating GPR33 studies should consider the following methodological approaches:

  • Sequence and allele characterization:

    • Determine which GPR33 variant/species to study based on research questions

    • Verify sequence integrity through multiple independent cloning attempts

    • Consider both human (pseudogenized) and functional orthologs from other species

  • Expression system selection:

    • Choose systems appropriate for GPCR expression (HEK293, CHO, Sf9)

    • Consider immune-relevant cell lines for physiological context

    • Implement inducible expression systems to control expression levels

  • Functional characterization approaches:

    • Implement multiple complementary signaling assays (cAMP, Ca²⁺, MAPK, Rho)

    • Consider both G-protein dependent and β-arrestin recruitment pathways

    • Include appropriate positive and negative controls in all assays

  • Technical considerations for pseudogene research:

    • Design primers/probes that distinguish between truncated and full-length transcripts

    • Implement strategies to distinguish endogenous versus engineered receptor expression

    • Consider both protein and mRNA detection methods

  • Experimental design considerations:

    • Integrate evolutionary context into research questions

    • Implement comparative approaches across species with different GPR33 statuses

    • Consider potential functional redundancy with related chemoattractant receptors

Researchers should approach GPR33 studies with awareness of both its current pseudogene status in humans and its evolutionary history as a functional receptor involved in immune responses, designing experiments that can bridge these different aspects of its biology.

What future research directions might uncover the full biological significance of GPR33?

Several promising research directions could reveal the complete biological significance of GPR33:

  • Identification of natural ligands:

    • High-throughput screening of pathogen-derived molecules

    • Testing of chemokines and inflammatory mediators

    • Investigation of microbiome-derived metabolites that might activate GPR33

  • Functional characterization in species with intact GPR33:

    • Creating knockout models in species with functional GPR33

    • Detailed phenotyping focusing on immune response parameters

    • Challenge studies with pathogens hypothesized to interact with GPR33

  • Evolutionary and population genetic studies:

    • Expanded analysis of GPR33 allele frequencies across human populations

    • Dating pseudogenization events more precisely across species

    • Correlation with historical disease exposures and migrations

  • Structural biology approaches:

    • Determining crystal or cryo-EM structures of GPR33 in different conformational states

    • Computational modeling of ligand binding sites

    • Molecular dynamics simulations of receptor activation

  • Functional consequences in humans with intact alleles:

    • Identifying individuals with functional GPR33 alleles for immunophenotyping

    • Comparing immune responses between individuals with different GPR33 genotypes

    • Investigating potential associations with disease susceptibility

  • Pathogen interaction studies:

    • Screening historical and current zoonotic pathogens for GPR33 interaction

    • Determining whether any pathogens exploit functional GPR33 for entry

    • Investigating whether GPR33 pseudogenization confers resistance to specific infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.