Recombinant Human Probable G-protein coupled receptor 34 (GPR34)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Human Probable G-protein coupled receptor 34 (GPR34) is a synthetically produced form of the human GPR34 receptor, a class A GPCR implicated in immune modulation, cancer progression, and neuropathic pain. GPR34 recognizes lysophosphatidylserine (LysoPS) as its primary ligand and is associated with signaling pathways such as NF-κB, AP1, and TGF-β/Smad . Recombinant GPR34 is generated by inserting the human GPR34 gene into heterologous expression systems (e.g., HEK293 cells, wheat germ) for structural, functional, and therapeutic studies .

Production Systems and Applications

Recombinant GPR34 is produced in diverse systems, each offering distinct advantages:

  • HEK293 cells: Yields fully glycosylated, functional receptors suitable for signaling assays .

  • Wheat germ: Cost-effective for antigen production in antibody development .

  • Nanodisc-embedded: Stabilizes the receptor for structural studies (e.g., cryo-EM) .

Table 2: Recombinant GPR34 Production Platforms

Expression SystemPurityApplicationsReference
HEK293 cells>90%Signaling assays, drug screening
Wheat germUnspecifiedAntibody production, ELISA
Mammalian nanodiscHighCryo-EM, ligand-binding studies

Cancer

  • Salivary gland MALT lymphoma: GPR34 truncation mutants (e.g., Q340X) exhibit constitutive activation, resistance to apoptosis, and enhanced NF-κB/AP1 signaling .

  • Glioma: Overexpression promotes EMT via TGF-β/Smad signaling, increasing invasiveness (e.g., N-cadherin↑, E-cadherin↓) .

Neuropathic Pain

GPR34 activation in microglia upregulates proinflammatory mediators (e.g., iNOS). Antagonist YL-365 (IC₅₀ = 17 nM) alleviates hyperalgesia in murine models .

Autoimmunity

LysoPS-GPR34 signaling in dendritic cells and macrophages modulates immune responses, linking it to diseases like lupus and Sjögren’s syndrome .

Therapeutic Targeting

  • Antagonist development: Structure-guided design identified YL-365, which occupies the hydrophobic cleft and inhibits GPR34 signaling .

  • Clinical relevance: Targeting GPR34 may benefit lymphoma (receptor hyperactivation) and neuropathic pain (microglial inflammation) .

Future Directions

  • Clarify LysoPS regioselectivity (sn-2 vs. sn-3) in physiological contexts .

  • Develop isoform-specific agonists/antagonists using cryo-EM insights .

  • Explore GPR34’s role in tumor-microenvironment crosstalk .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparation.
Shelf Life
The shelf life of our products can vary depending on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles to preserve product integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your order.
Synonyms
GPR34; Probable G-protein coupled receptor 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST
Uniprot No.

Target Background

Function
Orphan receptor.
Gene References Into Functions
  1. By monitoring fused FLAG-tag and conformation-sensitive native epitope during expression of GPR34 mutants, a tri-basic motif in the first intracellular loop was identified as a key topogenic signal that dictates the orientation of transmembrane domain-1. PMID: 27086875
  2. GPR34 knockdown impairs the proliferation and migration of HGC-27 gastric cancer cells in vitro, suggesting a potential therapeutic implication for gastric cancer. PMID: 25673461
  3. The up-regulation of GPR34 expression in human gastric carcinoma may play a crucial role in tumor progression and determine patient prognosis. PMID: 23836308
  4. Current studies confirm that GPR34 is a cellular receptor for LysoPS, particularly those with a fatty acid at the sn-2 position. PMID: 22343749
  5. These findings are the first to identify a role for GPR34 in lymphoma cell growth, provide insight into GPR34-mediated signaling, and identify a genetically unique subset of MZLs that express high levels of GPR34. PMID: 22966169
  6. Data demonstrate that multiple translation initiation starts and alternative splicing contribute to the supragenomic diversification of GPR34. PMID: 16338117

Show More

Hide All

Database Links

HGNC: 4490

OMIM: 300241

KEGG: hsa:2857

STRING: 9606.ENSP00000367378

UniGene: Hs.495989

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed.

Q&A

What is GPR34 and what are its key structural characteristics?

GPR34 is an X-chromosomally encoded 7-transmembrane G-protein coupled receptor that regulates key biological functions including cellular growth, motility, apoptosis, and gene transcription . It belongs to the P2Y receptor family and has been implicated in the progression of several cancers . The receptor contains important structural elements including phosphorylation motifs in its C-terminus that are crucial for receptor desensitization following ligand binding . Notably, the first intracellular loop contains a tribasic RKR motif which functions as a key topogenic signal determining the orientation of the first transmembrane domain .

What is the natural ligand for GPR34 and how is it generated?

Lysophosphatidylserine (LysoPS) has been identified as the primary ligand for GPR34 . LysoPS is generated through the hydrolysis of phosphatidylserine (PS) by phospholipase enzymes. Specifically, phospholipase A1 (PLA1) catalyzes the synthesis of 2-acyl-LysoPS, while phospholipase A2 (PLA2) mediates the production of 1-acyl-LysoPS . Both forms can activate GPR34, though 2-acyl-LysoPS appears to be more potent . The metabolism of phosphatidylserine on apoptotic cells by phospholipases released from inflamed tissues represents a potential physiological mechanism for GPR34 activation in disease conditions.

What is the expression pattern of GPR34 in normal tissues?

GPR34 shows a ubiquitous expression pattern in both murine and human tissues . More detailed analyses demonstrate GPR34 expression in specific cell lineages, particularly those of myeloid origin, including:

  • Myeloid progenitor cell line HL-60

  • K562 cells and WEHI-3B cells

  • The macrophage cell line RAW 264.1

  • The murine mast cell line P815

This expression pattern suggests a granulocytic/monocytic distribution that is consistent with the ubiquitous expression observed in tissues .

How is GPR34 implicated in cancer progression?

Several studies have documented elevated expression levels of GPR34 in multiple malignancies, including:

  • Cervical cancer

  • Metastatic melanoma

  • MALT lymphoma

  • BCR/ABL-positive leukemia

  • Gastric cancer

  • Colorectal cancer

GPR34 plays essential roles in tumor development and progression across these cancer types. Mechanistically, overexpression of GPR34 in lymphoma and HeLa cells results in phosphorylation of ERK, PKC, and CREB; induces CRE, AP1, and NF-κB-mediated gene transcription; and increases cell proliferation . In gastric cancer specifically, GPR34 promotes proliferation of HGC-27 cells via the PI3K/AKT pathway .

How do GPR34 mutations contribute to salivary gland MALT lymphoma?

GPR34 translocation and mutation are specifically associated with salivary gland MALT lymphoma (SG-MALT-lymphoma) . The majority of GPR34 mutations in this context are clustered in the C-terminus of the receptor, resulting in truncated proteins that lack the phosphorylation motif important for receptor desensitization . Functional studies have demonstrated that:

  • GPR34 Q340X truncation mutants confer significantly increased resistance to apoptosis and greater transforming potential than the wild-type receptor

  • The truncation mutant exhibits significantly delayed internalization after ligand stimulation

  • GPR34 truncation mutants show enhanced signaling capacity, particularly for CRE, NF-κB, and AP1 reporter activities

  • These effects are amplified in the presence of ligand (LysoPS) stimulation

These findings together provide a mechanistic link between GPR34 mutations and the development of SG-MALT-lymphoma.

What in vitro models are available for studying GPR34 function?

Researchers have developed several in vitro models to study GPR34 function:

  • Stable knockdown models: GPR34 knockdown cell lines, particularly in cancer cell lines like LS174T colon cancer cells, allow for studying the effects of GPR34 reduction on cell proliferation, apoptosis, and colony formation .

  • Isogenic expression systems: Isogenic Flp-InTRex293 cell lines that stably express a single copy of GPR34 or its various mutants enable controlled comparative functional studies . These systems allow for:

    • Apoptosis resistance assays

    • Transforming potential assessments

    • Receptor internalization studies

    • Multiple signaling pathway analyses using reporter assays

  • Antibody blocking approaches: GPR34 monoclonal antibody (Mab) blocking provides another method to investigate the functional importance of GPR34 in cancer cell proliferation .

  • Recombinant expression systems: COS-7 cells can be transiently co-transfected with GPR34 constructs and chimeric G proteins (such as Gαqi4) to study specific pathway activation and inositol phosphate accumulation .

What assays can be used to study the effects of GPR34 on cellular proliferation?

Multiple complementary assays have been employed to characterize the effect of GPR34 on cancer cell proliferation:

  • CCK-8 assay: This colorimetric assay is used to measure cell viability and proliferation in GPR34 knockdown or overexpression models .

  • Colony formation assay: This technique assesses the ability of cells to form colonies, providing insights into the long-term effects of GPR34 modulation on proliferative capacity .

  • Xenograft tumor growth models: In vivo models using immunocompromised mice can evaluate the effects of GPR34 manipulation on tumor growth, providing a more comprehensive understanding of its role in cancer progression .

  • Reporter gene assays: Dual luciferase reporter assays can measure the activation of proliferation-related transcription factors downstream of GPR34, such as CRE, AP1, and NF-κB .

How can GPR34 signaling pathways be experimentally evaluated?

Several approaches can be used to investigate the signaling pathways activated by GPR34:

  • Dual luciferase reporter assays: These assays can measure the activation of multiple signaling pathways including:

    • CRE (cAMP/PKA pathway)

    • NF-κB

    • AP1 (MAPK/JNK pathway)

    • SRF-RE (RhoA pathway)

    • SRE (MAPK/ERK pathway)

    • ISRE, TCF/LEF-RE, and NFAT-RE pathways

  • Western blot analysis: This technique can detect the phosphorylation status of downstream signaling molecules such as ERK, PKC, CREB, and AKT .

  • Cyclic AMP measurements: These can be performed using technologies like AlphaScreen® to evaluate G protein-dependent signaling .

  • Phospholipase activity assays: Commercial assays can measure PLA2 activities in cells expressing GPR34 or its mutants, and free fatty acid release can be measured to assess combined PLA1 and PLA2 activities .

How do GPR34 mutations affect receptor function and signaling?

Different GPR34 mutations exhibit distinct functional effects:

  • GPR34 Q340X truncation mutation:

    • Significantly delays receptor internalization after ligand stimulation

    • Enhances resistance to apoptosis

    • Increases transforming potential

    • Significantly activates CRE, NF-κB, and AP1 reporter activities, particularly with ligand stimulation

    • Shows the highest level of associated phospholipase activities

    • Has a higher predicted binding probability to Gαi3, Gαo, and Gα15 G-proteins

  • GPR34 D151A mutation:

    • Activates NF-κB and AP1 reporter activities, though to a lesser extent than Q340X

    • Shows enhanced sensitivity to ligand stimulation

    • Exhibits increased phospholipase activities compared to wild-type

  • GPR34 R84H mutation:

    • Shows no apparent difference from wild-type in reporter activities regardless of ligand stimulation

    • Affects the tribasic RKR motif in the first intracellular loop

    • The conservative amino acid replacement may explain its lack of major functional impact in standard assays

What is the relationship between GPR34 and lymphoepithelial lesions in salivary gland MALT lymphoma?

Research has revealed a potential paracrine stimulation model connecting lymphoepithelial lesions (LELs) to salivary gland MALT lymphoma via GPR34:

  • Phospholipase A1 is abundantly expressed in the duct epithelium of salivary glands and those involved in LELs .

  • PLA is released by LELs and hydrolyzes phosphatidylserine exposed on apoptotic cells, generating lysophosphatidylserine (LysoPS), the ligand for GPR34 .

  • LysoPS then provides paracrine stimulation to malignant B cells expressing GPR34, particularly those with activating mutations .

  • This creates a microenvironment that promotes lymphoma development and progression through enhanced GPR34 signaling .

This model provides a mechanistic explanation for the specific association of GPR34 genetic alterations with salivary gland MALT lymphoma.

What methods can be used to generate and validate GPR34-deficient animal models?

GPR34-deficient mouse models can be generated through the following approach:

  • Construction of a conditional GPR34 knockout allele using a targeting vector containing:

    • A neomycin cassette flanked by two loxP sites

    • A third loxP site inserted into the 5' region of GPR34

  • Homologous recombination in ES cells, followed by:

    • Screening for neomycin-resistant ES cells

    • Injection of positive ES cell clones into blastocysts

    • Breeding of chimeric offspring into the desired genetic background (e.g., C57BL/6)

  • Validation of the knockout through:

    • PCR verification of correct homologous recombination

    • Sequencing of PCR products containing sequences of the targeting construct and genomic flanking regions

    • Verification of proper deletion of the GPR34 coding sequence

  • Generation of complete GPR34-deficient mice by breeding female heterozygous mice carrying the mutant loxP GPR34-Neo cassette locus with homozygous male EIIa-Cre mice .

These GPR34-deficient models can then be used to study the receptor's physiological functions and its role in disease processes.

What are the most promising therapeutic applications of GPR34 research?

Based on current research findings, GPR34 represents a potential therapeutic target in multiple cancers, particularly:

  • Colorectal cancer, where high GPR34 expression correlates with poorer patient survival .

  • Salivary gland MALT lymphoma, where specific GPR34 mutations enhance receptor signaling and contribute to lymphoma development .

  • Other cancers including cervical cancer, metastatic melanoma, and gastric cancer, where GPR34 overexpression has been documented .

Therapeutic approaches could include:

  • Development of GPR34 antagonists to block receptor signaling

  • Targeting downstream pathways activated by GPR34 (PI3K/AKT, MAPK/JNK)

  • Inhibition of PLA1/2 to reduce production of the GPR34 ligand, lysophosphatidylserine

  • Monoclonal antibodies against GPR34 to block receptor function

What key questions remain to be addressed in GPR34 research?

Despite significant advances, several important questions about GPR34 biology remain:

  • The precise physiological roles of GPR34 in normal tissues and immune function

  • The mechanisms by which GPR34 overexpression or mutation drives specific cancer types

  • The complete G-protein coupling profile of GPR34 and how this might vary across different tissues

  • The potential for targeting GPR34 or its signaling pathways for therapeutic benefit in cancer

  • Whether GPR34 plays different roles in different stages of cancer progression

  • How GPR34 signaling interacts with other oncogenic pathways in cancer cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.