Recombinant Human Probable G-protein coupled receptor 37 (GPR37)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR37; Prosaposin receptor GPR37; Endothelin B receptor-like protein 1; ETBR-LP-1; G-protein coupled receptor 37; Parkin-associated endothelin receptor-like receptor; PAELR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-613
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSW DLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFL QISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAG HEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVMC LSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVIFHELTKK WLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVI WVGALLLALPEVVLRQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARLWWY FGCYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCII PENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAFMECCCC CCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC
Uniprot No.

Target Background

Function
GPR37 acts as a receptor for the neuroprotective and glioprotective factor prosaposin. Ligand binding triggers endocytosis, followed by an ERK phosphorylation cascade.
Gene References Into Functions
  1. REG4 promotes peritoneal metastasis of gastric cancer through GPR37 and triggers a positive feedback loop. PMID: 27036049
  2. GPR37 has been identified as a component of the CASPR2-MUPP1 complex in the brain. PMID: 25977097
  3. GPR37 may play a significant role in the pathogenesis of hepatocellular carcinoma by influencing the proliferation of HCC cells. PMID: 25169131
  4. GPR37 exhibits a positive role in the proliferation of multiple myeloma cells. PMID: 24290813
  5. GPR37 and GPR37L1 serve as receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin. PMID: 23690594
  6. Research findings suggest that certain alleles in GPR37 are associated with the detrimental effects of ASD. GPR37 is involved in modulating dopamine uptake through its interaction with the dopamine transporter, and it regulates behavioral responses to dopaminergic drugs. PMID: 23251443
  7. Studies demonstrate that panneuronal expression of Parkin substrate Pael-R results in age-dependent selective degeneration of Drosophila dopaminergic (DA) neurons; coexpression of Parkin degrades Pael-R and mitigates its toxicity. PMID: 12670421
  8. Glup/PACRG suppresses cell death triggered by accumulation of unfolded Pael receptor and facilitates the formation of Pael-R inclusions. PMID: 14532270
  9. These findings indicate that 4-PBA alleviates ER stress by directly reducing the amount of misfolded protein, including Pael-R accumulated in the ER. PMID: 16539653
  10. Parkin-ko/Pael-R-tg mice serve as an AR-JP mouse model exhibiting chronic and selective loss of catecholaminergic neurons. PMID: 18691389
  11. Data suggest that GPR37 overexpression can induce cellular autophagy, potentially preventing the selective degeneration of GPR37-expressing neurons, as observed in Parkinson's disease and related neurodegenerative disorders. PMID: 19218498
  12. GPR37 surface trafficking in heterologous cells can be significantly enhanced by N-terminal truncation, coexpression with other receptors, and coexpression with syntenin-1. PMID: 19799451

Show More

Hide All

Database Links

HGNC: 4494

OMIM: 602583

KEGG: hsa:2861

STRING: 9606.ENSP00000306449

UniGene: Hs.406094

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the unfolded protein may

Q&A

What is GPR37 and where is it primarily expressed?

GPR37 is an orphan G protein-coupled receptor (oGPCR) with significant expression in the central nervous system (CNS), particularly in the spinal cord and oligodendrocytes. It belongs to the larger family of GPCRs, which constitute approximately 35% of FDA-approved medication targets . While its cellular signaling mechanisms remain incompletely understood, GPR37 has garnered interest due to its potential role in several neurological conditions, including Parkinson's disease, inflammatory processes, pain perception, autism spectrum disorders, and various brain tumors .

The receptor's amino acid sequence shows significant homology to peptide-specific GPCRs, suggesting potential peptidergic ligands, though complete validation of endogenous ligand-receptor pairings remains challenging . Understanding the distribution and expression patterns of GPR37 provides fundamental insights into its physiological roles and potential as a therapeutic target.

How is GPR37 implicated in Parkinson's disease pathophysiology?

GPR37 has a well-documented association with Parkinson's disease (PD) through several mechanisms:

  • Presence in Lewy bodies: Misfolded GPR37 is prominently found within Lewy bodies, making it a biomarker for PD pathology .

  • Mutations and ER stress: Mutations in GPR37 are implicated in endoplasmic reticulum (ER) stress, leading to loss-of-function effects that exacerbate dopaminergic neuron death by promoting the accumulation and aggregation of misfolded proteins .

  • Juvenile Parkinson's disease: Loss-of-function mutations in GPR37 are associated with autosomal recessive juvenile PD, an early-onset form of the disease .

  • Biomarker potential: Peptides from the N-terminus-cleaved domain of GPR37 (ecto-GPR37) show increased levels in the cerebrospinal fluid of PD patients but not in Alzheimer's disease patients, suggesting potential utility as a specific biomarker .

  • Therapeutic implications: In cell culture models of PD with GPR37 overexpression, indole-3-propionic acid has been shown to prevent β-amyloid aggregation and ER stress, resulting in reduced neuronal cell death .

These findings collectively highlight the multifaceted roles of GPR37 in PD pathogenesis and its potential as both a biomarker and therapeutic target.

What are the current approaches to studying GPR37 structure in the absence of crystal structures?

Due to the lack of high-resolution structures for orphan GPCRs including GPR37, researchers rely on several computational and experimental approaches:

  • Homology modeling: This approach leverages the increasing availability of high-quality protein 3D structures, particularly those obtained through cryo-electron microscopy (Cryo-EM), to predict the 3D structure of GPR37 based on sequence similarity with other GPCRs .

  • Ligand-sensitive modeling methods: These address the limitation of traditional homology modeling that often neglects ligand information present in experimental structures, though they require time and expertise for manual interventions .

  • Multiple template modeling: In cases of low sequence similarity, using multiple templates can enhance accuracy, although careful template selection is necessary to avoid alignment aberrations .

  • Model refinement techniques: Methods for model refinement and coordinate adjustments parallel to the native state contribute to better coverage and accuracy. Molecular dynamics simulations play a crucial role in refining generated models .

  • Model assessment parameters: Various parameters like DOPE score, TM score, and RMSD value are used for model comparison, with the choice of determinant parameter based on the modeling purpose .

The development of fully automated homology modeling tools capable of handling ligand-related challenges remains a significant goal in the field. These computational approaches provide valuable starting points for understanding receptor-ligand interactions and designing selective modulators for GPR37 .

What are the known or proposed endogenous ligands for GPR37 and how were they identified?

Research into GPR37 ligands has yielded several candidates:

  • Head activator (HA): This invertebrate-derived neuropeptide has been shown to activate Ca²⁺ signaling via GPR37 using the Gα16/aequorin assay with an EC₅₀ value of 3.3 nM. Additionally, HA has been reported to modulate NFAT signaling and inhibit Forskolin-mediated cAMP production through GPR37 .

  • Osteocalcin (OCN): This bone-derived protein crucial for brain development and neural cognitive function interacts with GPR37 to regulate oligodendrocyte differentiation, myelination, myelin production, and remyelination after demyelinating injury. Dose-response studies revealed that OCN activates GPR37 with an apparent EC₅₀ of 10.2 nM .

The identification of these ligands has been challenging due to difficulties in validating ligand-GPR37 pairings using recombinant GPR37 expressed in HEK293 cells. Recent successful approaches have turned to primary cell cultures for ligand identification . The OCN/GPR37 regulatory axis, in particular, shows promise for treating inflammatory diseases, as OCN treatment has demonstrated protective effects against LPS-induced inflammation (effects absent in GPR37-deficient mice) .

How does GPR37 expression correlate with prognosis in gliomas and other cancers?

GPR37 expression shows significant correlations with prognosis across various cancer types:

CharacteristicsTotal (N)Odds Ratio (95% CI)P value
CNS WHO grade (G4 vs. G2 & G3)698
G4285Reference
G2 & G34130.380 (0.069–0.692)<0.001
Histological Type691
Glioblastoma, IDH wildtype247Reference
Oligodendroglioma, IDH mutation, 1p/19q-codel1720.242 (−0.172–0.656)<0.001
Astroctyoma, IDH mutation2720.397 (0.040–0.754)<0.001
CDKN2A/B homozygous deletion705
Non-homdel555Reference
Homdel1501.865 (1.495–2.234)<0.001
Age699
≤60556Reference
>601431.466 (1.095–1.836)0.043
Gender699
Male401Reference
Female2981.015 (0.715–1.315)0.922
Primary therapy outcome465
PR & CR205Reference
PD & SD2601.123 (0.756–1.490)0.536

Table 1: GPR37 expression correlation with clinicopathological characteristics in glioma patients .

What molecular mechanisms underlie GPR37's role in cancer cell proliferation and invasion?

GPR37 influences cancer cell behavior through several molecular pathways:

  • TGF-β1/Smad signaling: Gain- or loss-of-function assays have demonstrated that increased GPR37 expression enhances the activation of TGF-β1, Smad2, and Smad3 phosphorylation, leading to improved proliferation, migration, and invasion of carcinoma cells in vitro .

  • PI3K-Akt signaling pathway: Transient knockdown of GPR37 using siRNA in HuH7 cells has shown a significant decrease in hepatoma cell apoptosis by activating the PI3K-Akt signaling pathway. AKT plays a crucial role in promoting cell survival and growth .

  • Cell cycle regulation: The upregulation of GPR37 in human glioma U251 cells leads to increased proliferation, a decrease in G1/G0 phase cells, an increase in S and G2 phase cells, and enhanced phosphorylation of p-AKT (Ser473), suggesting activation of signaling pathways associated with cell survival and proliferation .

  • REG4-GPR37 complex: GPR37 is found in the same complex as REG4, which mediates signal transduction and promotes peritoneal metastasis of gastric cancer cells. High expression of REG4 is associated with advanced stage and poor survival prognosis in gastric cancer patients .

  • Cell adhesion modulation: In multiple myeloma cells, GPR37 is implicated in regulating cell proliferation through the modulation of cell adhesion ability and AKT and ERK activity .

These diverse mechanisms highlight GPR37's multifaceted role in cancer biology and suggest that targeting this receptor could be a promising approach for developing novel treatments for various types of cancers and their metastases .

What techniques are recommended for analyzing GPR37 expression in patient samples?

Researchers employ multiple complementary techniques to analyze GPR37 expression:

These methodologies provide complementary information about GPR37 expression and its clinical relevance, enabling researchers to comprehensively assess this receptor's role in various pathological contexts.

What are the challenges in establishing reliable in vitro models for studying GPR37 function?

Several challenges exist in developing reliable in vitro models for GPR37 research:

  • Receptor misfolding: GPR37 has a tendency to misfold when overexpressed in heterologous cell systems, which can lead to aggregation and ER stress, potentially masking its natural signaling properties .

  • Ligand validation difficulties: There are challenges in validating ligand-GPR37 pairings using recombinant GPR37 expressed in common cell lines like HEK293 cells, necessitating the use of primary cell cultures for successful ligand identification .

  • Lack of structural information: The absence of high-resolution structures for GPR37 hinders structure-based drug design and understanding of ligand-receptor interactions .

  • Appropriate cell models: Selecting cellular models that maintain proper receptor folding, trafficking, and signaling is crucial. Primary neural cultures may better recapitulate the native environment of GPR37 compared to heterologous expression systems .

  • Signaling pathway complexity: The exact signaling pathways activated by GPR37 remain incompletely characterized, making it difficult to establish appropriate readouts for receptor activity .

To overcome these challenges, researchers have turned to:

  • Using primary cell cultures instead of recombinant systems for ligand identification

  • Developing improved homology models to guide experimental design

  • Employing multiple complementary assay systems to validate receptor function

  • Investigating cell-specific expression and localization using advanced techniques like single-cell RNA sequencing and immunohistochemistry

These approaches help provide more physiologically relevant insights into GPR37 function while minimizing artifacts associated with heterologous expression systems.

What are the most promising therapeutic approaches targeting GPR37?

Based on current research, several therapeutic approaches targeting GPR37 show promise:

  • Ligand-based approaches:

    • Developing small molecule agonists, antagonists, and allosteric modulators that selectively target GPR37 .

    • Utilizing the osteocalcin (OCN)/GPR37 regulatory axis for treating inflammatory diseases, based on OCN's protective effects against LPS-induced inflammation .

    • Exploring indole-3-propionic acid (IPA) as a therapeutic agent, as it has shown effectiveness in preventing β-amyloid aggregation and ER stress in PD models with GPR37 overexpression .

  • Prevention of protein aggregation:

    • Developing compounds that inhibit GPR37 aggregation, similar to how dextromethorphan mitigates buprenorphine-induced GPR37 accumulation and associated proapoptotic ER stress responses .

  • Cancer therapeutics:

    • Targeting GPR37 in various cancers where it promotes proliferation, migration, and invasion, particularly through modulation of TGF-β1/Smad and PI3K-Akt signaling pathways .

    • Disrupting the REG4-GPR37 complex that promotes peritoneal metastasis in gastric cancer .

  • Remyelination strategies:

    • Leveraging GPR37's role in oligodendrocyte differentiation, myelination, and remyelination to develop treatments for demyelinating conditions .

Future therapeutic development will benefit from high-throughput screening and structure-based drug design approaches to identify novel compounds that selectively modulate GPR37 signaling. Such ligands could serve as chemical leads for further optimization and valuable pharmacological tools for elucidating receptor functions, potentially leading to novel therapeutics for neurological disorders and cancer .

What are the critical knowledge gaps that need to be addressed to advance GPR37 research?

Several critical knowledge gaps must be addressed to advance GPR37 research:

  • Physiological functions and endogenous ligands: The physiological functions of GPR37 and a complete understanding of its endogenous ligands remain largely unknown. Validating and characterizing proposed ligand-receptor interactions and elucidating downstream signaling pathways is crucial .

  • Cell-specific expression and localization: Further investigation into the cell-specific expression and localization of GPR37 in different CNS cell types is essential for understanding its functional implications. Advanced techniques such as single-cell RNA sequencing and immunohistochemistry can provide valuable insights into expression patterns and subcellular localization .

  • Structural characterization: Solving crystal structures and elucidating the molecular interactions of GPR37 would significantly advance our understanding. This includes characterizing consequences of interactions with PDZ domain-containing proteins and other binding partners to reveal downstream signaling cascades .

  • Appropriate preclinical models: Development of preclinical models that accurately recapitulate the pathophysiological aspects of human diseases associated with GPR37 dysfunction is crucial. Genetically modified animal models, such as conditional knockout or transgenic mice targeting GPR37, can serve as valuable tools for in vivo studies .

  • Pharmacological tools: There is a need for potent and specific ligands, including small molecule agonists, antagonists, and allosteric modulators. These would serve as valuable tools for elucidating receptor functions and could potentially lead to therapeutic development .

Addressing these knowledge gaps will require multidisciplinary approaches combining structural biology, molecular pharmacology, cell biology, and translational research to fully unravel the therapeutic potential of GPR37.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.