Recombinant Human Probable G-protein coupled receptor 88 (GPR88)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Human GPR88 refers to the in vitro synthesized version of the 384-amino-acid protein encoded by the GPR88 gene (UniProt ID: Q9GZN0). It features a 7-transmembrane domain structure typical of class A GPCRs and is tagged for purification (e.g., Strep Tag in recombinant forms) .

PropertyValue
OrganismHomo sapiens
Length384 amino acids
Transmembrane Domains7
Expression SystemCell-free protein synthesis (CFPS)
Purity>70-80% (SDS-PAGE/WB)
Key DomainsCytoplasmic TM5-TM6 interface

Functional Roles and Signaling Modulation

GPR88 modulates striatal circuits through:

  • GPCR Cross-Talk: Physically interacts with opioid receptors (µOR, δOR, κOR), dopamine D2, and muscarinic receptors via BRET assays, blunting their G-protein signaling by up to 70% .

  • β-Arrestin Recruitment Inhibition: Reduces β-arrestin-2 recruitment for all tested GPCRs, independent of physical proximity .

  • Behavioral Regulation: Knockout mice exhibit hyperactivity, impaired motor coordination, and enhanced morphine-induced analgesia and withdrawal .

Neurological Disorders

  • Parkinson’s Disease: GPR88 ablation exacerbates dopamine hypersensitivity, suggesting a role in motor control .

  • Addiction: Enhanced alcohol-seeking behavior and impulsivity in Gpr88⁻/⁻ mice .

  • Psychiatric Disorders: Linked to schizophrenia and bipolar disorder via human genetic associations .

In Vitro Applications

  • Drug Screening: Recombinant GPR88 enables high-throughput assays for allosteric modulators targeting the TM5-TM6 pocket .

  • Signal Transduction Studies: Used to map Gi1 coupling and water-mediated activation pathways .

Challenges and Future Directions

  • Orphan Receptor Status: Endogenous ligand remains unidentified, complicating therapeutic targeting .

  • Structural Dynamics: Poorly resolved extracellular loops hinder full mechanistic understanding .

  • Bias Signaling: Differential effects on G-protein vs. β-arrestin pathways require further exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR88; STRG; Probable G-protein coupled receptor 88; Striatum-specific G-protein coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLL GLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWA PRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC AAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPL VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA AVAATAVPAVSQAQLGTRAAGQHW
Uniprot No.

Target Background

Function
Probable G-protein coupled receptor involved in a wide range of behavioral responses including motor activities, spatial learning, and emotional processing. It may play a regulatory role in cognitive and motor function.
Gene References Into Functions
  1. A study designed and synthesized a series of 2-PCCA analogues with various substituents at the phenyl ring of the aniline moiety to determine the structure-activity relationship (SAR) in this region. SAR studies suggested the presence of a hydrophobic pocket in the GPR88 binding site interacting with the aniline region of 2-PCCA. PMID: 27499251
Database Links

HGNC: 4539

OMIM: 607468

KEGG: hsa:54112

STRING: 9606.ENSP00000314223

UniGene: Hs.170053

Involvement In Disease
Chorea, childhood-onset, with psychomotor retardation (COCPMR)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Nucleus.
Tissue Specificity
Expressed predominantly in the striatum.

Q&A

What is GPR88 and where is it primarily expressed?

GPR88 is a striatal-enriched orphan G protein-coupled receptor weighing approximately 41 kDa. It shows variable expression during development in the brain of rodents, monkeys, and humans. The receptor is predominantly expressed in the striatum and extended amygdala, particularly in medium spiny GABAergic neurons. It demonstrates enriched expression in dopamine D1 and D2 receptor-expressing medium spiny neurons, making it a critical component of striatal circuitry . GPR88 is also known as Striatum-Expressed Orphan G-Protein-Coupled Receptor and plays significant roles in motor control, emotional processing, and cognitive function regulation .

What structural features characterize GPR88?

Recent cryo-EM studies have revealed the three-dimensional structure of human GPR88-Gi1 signaling complex with and without synthetic agonists. GPR88 exhibits distinctive structural features including a unique activation mechanism and a water-mediated polar network that distinguishes it from other GPCRs. The receptor contains an extracellular orthosteric site that may accommodate a putative endogenous ligand, though this ligand remains unidentified. Additionally, an allosteric binding pocket has been identified at the cytoplasmic ends of transmembrane segments 5, 6, and the extreme C terminus of the α5 helix of Gi1 . These structural insights provide critical information for understanding GPR88's function and potential for therapeutic targeting.

How does GPR88 modulate GPCR signaling pathways?

GPR88 functions as a signaling modulator for multiple GPCRs through two primary mechanisms. First, it inhibits the activation of both G protein- and β-arrestin-dependent signaling pathways when co-expressed with opioid receptors. Second, GPR88 can decrease the G protein-dependent signaling of most receptors in close proximity while impeding β-arrestin recruitment by all receptors tested, regardless of physical proximity .

This unique buffering role has significant implications for striatal and opioid functions. GPR88 couples with the heterotrimeric G protein complex of the G(i) subfamily (GNAI1, GNB1, and GNG2), acting through a G(i)-mediated pathway. Additionally, it plays a role in attenuating D1 dopamine receptor-mediated cAMP response in ciliated cells and inhibits the beta-2 adrenergic receptor response in non-ciliated cells .

What protein-protein interactions has GPR88 been shown to form?

Bioluminescence resonance energy transfer (BRET1) saturation assays have demonstrated that GPR88 displays specific and saturated BRET signals when co-expressed with all three opioid receptors (δOR, κOR, and μOR), indicating close physical proximity (within 10 nm) and suggesting potential hetero-oligomer formation. Beyond opioid receptors, GPR88 also shows evidence of physical proximity with several striatal GPCRs, including muscarinic M1 and M4, dopamine D2, adenosine A2A, and orphan receptor GPR12 .

Interestingly, GPR88 does not appear to form close associations with all GPCRs - it shows unsaturated BRET signals with non-neuronal GPCRs like vasopressin V2R and chemokine CXCR4 receptors, and no evidence of proximity to the dopamine D1 receptor despite its enriched striatal expression. This selective hetero-oligomerization pattern suggests specificity in GPR88's modulatory functions .

What knockout models are available for studying GPR88 function?

Several GPR88 knockout models have been developed to investigate its functional roles:

The table below summarizes the phenotypic differences between these models:

PhenotypeTotal Gpr88 KOA2AR-Gpr88 KO
Locomotor activityIncreasedIncreased
Anxiety-like behaviorsDecreasedDecreased
Novelty preferenceIncreasedNo change
Novelty-suppressed feedingDecreasedNo change
Morphine-induced responsesEnhancedNot reported

What techniques are most effective for measuring GPR88-modulated signaling?

Several complementary techniques have proven valuable for studying GPR88-modulated signaling:

  • BRET1 saturation assays: Effective for measuring protein-protein interactions between GPR88 and other GPCRs, providing evidence of potential hetero-oligomerization. This approach involves tagging GPR88 with Luciferase Rluc8 (RLuc8) and partner GPCRs with Venus, then measuring energy transfer as an indication of proximity .

  • G protein signaling assays: Measuring receptor-mediated G protein activation through techniques such as [(35)S]-GTPγS binding assay, which quantifies nucleotide exchange at Gα subunits upon receptor activation .

  • β-arrestin recruitment assays: Assessment of β-arrestin-dependent signaling pathways using BRET-based approaches to measure receptor-arrestin interactions .

  • Behavioral testing paradigms: For in vivo assessment of GPR88 function, including tests for locomotor activity, anxiety-like behaviors (light/dark test, elevated plus maze), conditioned place preference (CPP), nociceptive thresholds (tail immersion and hot-plate tests), and extinction protocols for evaluating learning processes .

What neuropsychiatric disorders has GPR88 been linked to?

Gene association studies in humans have uncovered links between GPR88 function and several psychiatric, neurodevelopmental, and neurodegenerative disorders. These include:

  • Schizophrenia

  • Bipolar disorder

  • Speech delay

  • Chorea (a movement disorder characterized by involuntary, irregular, unpredictable movements)

The enriched expression of GPR88 in the striatum, a brain region involved in motor control, reward processing, and cognitive functions, supports its potential role in these disorders. Additionally, the modulatory effects of GPR88 on dopaminergic and glutamatergic transmission, which are implicated in several neuropsychiatric conditions, further substantiate its relevance to these pathologies .

How might modulation of GPR88 be therapeutically beneficial?

GPR88 modulation holds promise for therapeutic intervention in several ways:

  • Anxiety disorders: Given that GPR88 deletion reduces anxiety-like behaviors, antagonists targeting GPR88 might have anxiolytic properties. Specifically, targeting GPR88 in A2AR-expressing neurons could produce anti-anxiety effects without affecting other behaviors like novelty preference .

  • Addiction and substance use disorders: The interaction between GPR88 and opioid receptors suggests potential applications in addiction treatment. In Gpr88 knockout mice, morphine-induced locomotor sensitization, withdrawal, and supra-spinal analgesia were facilitated, indicating that GPR88 normally constrains these responses. Modulating GPR88 function might therefore help manage addiction or withdrawal symptoms .

  • Movement disorders: Given GPR88's high expression in the striatum and its impact on motor activities, targeted modulation could potentially address movement disorders like chorea .

The recently described cryo-EM structures of the human GPR88-Gi1 signaling complex provide a structural framework for understanding ligand binding and activation mechanisms, which will facilitate innovative drug discovery efforts targeting this receptor .

What is known about potential endogenous ligands for GPR88?

The lack of known endogenous ligands has complicated research into GPR88 function, necessitating the use of genetic approaches (like knockout models) rather than pharmacological manipulation. The development of synthetic ligands, such as the allosteric modulator (1R, 2R)-2-PCCA, represents an important advance in this field .

How do GPR88's effects on GPCR signaling differ by brain region?

The behavioral consequences of Gpr88 deletion on morphine-induced responses differ depending on the behavior assessed, suggesting region-specific roles for GPR88. For example:

  • In tail immersion tests (involving spinal responses), morphine's analgesic effects were blunted in Gpr88 -/- mice compared to wildtype animals.

  • In contrast, in the hot-plate test (measuring supraspinal analgesia), jumping latency under morphine challenge was longer in mutant compared to wild-type animals, indicating facilitated supraspinal morphine-induced analgesia in Gpr88 null mice .

These opposing effects point to brain region-specific roles of GPR88 in modulating opioid signaling. Additionally, the selective reduction of Gpr88 mRNA in D2R-expressing neurons in conditional A2AR-Gpr88 knockout mice produces some but not all of the phenotypes observed in total knockout animals, further supporting pathway-specific functions of GPR88 .

What methodological approaches can resolve contradictory findings in GPR88 research?

Contradictory findings regarding GPR88 function can be addressed through several methodological approaches:

  • Cell-type specific manipulations: Using conditional knockout strategies (like the A2AR-Gpr88 KO model) to target GPR88 in specific neuronal populations can help dissect circuit-specific functions and resolve seemingly contradictory behavioral outcomes .

  • Combined in vitro and in vivo approaches: Integrating findings from heterologous expression systems with those from native tissues and in vivo models provides a more complete understanding of GPR88 function across biological contexts .

  • Comprehensive signaling pathway analysis: Examining both G protein and β-arrestin signaling pathways simultaneously can reveal biased effects of GPR88 on different downstream effectors .

  • Structural biology approaches: Recent advances in cryo-EM have yielded high-resolution structures of GPR88 in complex with signaling partners, providing molecular insights that can help interpret functional data .

  • Development of selective ligands: The identification and characterization of selective GPR88 modulators will enable more precise pharmacological manipulation to complement genetic approaches .

What technological advances will accelerate GPR88 research?

Several emerging technologies are poised to advance our understanding of GPR88:

  • Cryo-EM and computational modeling: The recent determination of GPR88-Gi1 complex structures represents a significant breakthrough. Further structural studies, combined with molecular dynamics simulations, will provide deeper insights into GPR88's activation mechanism and ligand interactions .

  • Single-cell transcriptomics and spatial transcriptomics: These approaches can reveal cell type-specific expression patterns of GPR88 with unprecedented resolution, helping to identify novel cellular contexts where GPR88 functions.

  • CRISPR-based genome editing: Advanced gene editing techniques enable more precise manipulation of GPR88 in various model systems, including the introduction of specific mutations identified in human disorders.

  • Chemogenetics and optogenetics: These tools allow temporally precise control of neuronal populations expressing GPR88, facilitating the dissection of its role in specific circuits and behaviors.

  • Artificial intelligence for drug discovery: Machine learning approaches can accelerate the identification of novel GPR88 ligands by predicting binding affinities and functional outcomes based on structural information .

How can researchers effectively translate GPR88 findings from animal models to human applications?

Translational research on GPR88 faces several challenges but can be advanced through:

  • Comparative expression analysis: Detailed mapping of GPR88 expression across species (rodents, non-human primates, and humans) can identify conserved and divergent aspects of its biology.

  • Human-derived models: Utilizing induced pluripotent stem cells (iPSCs) from patients with disorders linked to GPR88 dysfunction to generate relevant neuronal populations for functional studies.

  • Cross-species behavioral paradigms: Developing behavioral assays that can be applied across species to facilitate translation of findings from rodents to humans.

  • Biomarker development: Identifying measurable indicators of GPR88 activity that can be assessed in both animal models and human subjects.

  • Genetic association studies: Expanding investigations of GPR88 variants in human populations with relevant neuropsychiatric disorders to strengthen the connection between basic research findings and clinical relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.