Recombinant Human Probable glutathione peroxidase 8 (GPX8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
GPX8; UNQ847/PRO1785; Probable glutathione peroxidase 8; GPx-8; GSHPx-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF WKPEEPIEVIRPDIAALVRQVIIKKKEDL
Uniprot No.

Target Background

Gene References Into Functions

Related Research:

  1. Evidence suggests that GPX8's conserved N-terminal transmembrane domain, in addition to its enzymatic function, plays a crucial role in regulating Ca2+ dynamics. This highlights a novel interaction between redox proteins and Ca2+ signaling/homeostasis. PMID: 28129698
  2. GPX8 is transcriptionally regulated by HIFalpha and influences growth factor signaling in HeLa cells. PMID: 25557012
  3. Findings regarding GPX8 induction in ER-stressed cells challenge the universal role of Ero1alpha as a cytoplasmic ROS producer under ER stress. PMID: 24566470
  4. Quantitative proteomics identifies the membrane-associated peroxidase GPx8 as a cellular target of the hepatitis C virus NS3-4A protease. PMID: 23929719
  5. Contrary to its previous classification as a secreted glutathione peroxidase, GPx8 is an endoplasmic reticulum-resident protein disulfide isomerase peroxidase. PMID: 21215271
Database Links

HGNC: 33100

KEGG: hsa:493869

STRING: 9606.ENSP00000423822

UniGene: Hs.289044

Protein Families
Glutathione peroxidase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural and functional characterization of GPX8?

GPX8 is a type II transmembrane protein with rare structural features belonging to the glutathione peroxidase family . It functions primarily as a metabolic enzyme involved in antioxidant activity. Research methodologies to characterize GPX8 should include protein structure analysis, subcellular localization studies using immunofluorescence microscopy, and enzymatic activity assays to measure its peroxidase function. Western blotting and qRT-PCR remain standard techniques for detection of protein and mRNA expression, respectively.

How does GPX8 expression vary across different tissue types and cancer subtypes?

GPX8 expression is significantly upregulated in mesenchymal cancer cell lines compared to epithelial cancer cell lines . Expression pattern analysis using the MERAV web portal reveals that GPX8 follows a similar expression pattern to known mesenchymal markers like DPYD, FN1, ZEB1, ZEB2, and CDH11 . In patient samples, GPX8 expression is particularly elevated in aggressive cancer subtypes. For example, in breast cancer, GPX8 expression is significantly higher in basal (aggressive) subtypes compared to luminal A (less aggressive) subtypes . Researchers should use both bioinformatic approaches (TCGA data analysis) and experimental validation (tissue microarrays) to comprehensively profile GPX8 expression across tissue types.

What are the optimal techniques for modulating GPX8 expression in experimental models?

For GPX8 knockdown studies, shRNA delivery via Lipofectamine 3000 has been successfully employed in glioblastoma cell lines . When designing knockdown experiments, researchers should target conserved regions of the GPX8 transcript and include appropriate scrambled controls. For overexpression studies, mammalian expression vectors containing the full-length GPX8 cDNA should be utilized. Expression validation should be performed at both mRNA (qRT-PCR) and protein (Western blot) levels. Functional validation following GPX8 modulation should include migration and invasion assays, as knockdown of GPX8 has been shown to suppress migrative and invasive phenotypes in glioblastoma cells .

How does GPX8 contribute to epithelial-mesenchymal transition (EMT) and cancer aggressiveness?

GPX8 expression is significantly upregulated during the EMT program, as demonstrated by unsupervised hierarchical clustering analysis of cancer cell lines' metabolic gene expression profiles . Gene set enrichment analysis (GSEA) of breast cancer samples from TCGA reveals a high correlation between GPX8 expression and EMT markers . Mechanistically, the GPX8/IL-6/STAT3 axis is essential for cancer cell transition to aggressive phenotypes. Cells lacking GPX8 express a nonfunctional IL-6 receptor that fails to interact with IL-6, preventing activation of the downstream JAK/STAT3 signaling pathway . To investigate this pathway, researchers should perform co-immunoprecipitation studies of IL-6 receptor complexes and analyze STAT3 phosphorylation status following GPX8 modulation.

How does the GPX8/IL-6/STAT3 axis regulate cancer cell plasticity and stemness?

The GPX8/IL-6/STAT3 axis represents a critical pathway by which metabolic enzymes can regulate cancer aggressiveness independently of proliferation effects . In cells lacking GPX8, the IL-6 receptor becomes nonfunctional and fails to interact with IL-6, preventing activation of the downstream JAK/STAT3 signaling pathway . This impaired signaling inhibits the transition of cancer cells to aggressive phenotypes and reduces stemness features. Researchers investigating this pathway should employ multiple approaches, including:

  • Co-immunoprecipitation to assess IL-6/IL-6R interaction

  • Western blotting for phosphorylated STAT3

  • Sphere formation assays to evaluate stemness

  • RNA-seq to identify transcriptional targets of the pathway

  • Rescue experiments introducing constitutively active STAT3 in GPX8-depleted cells

What is the relationship between GPX8 expression and DNA methylation in tumors?

Research indicates a correlation between GPX8 expression and reduced DNA methylation at the promoter region in several tumor types, particularly in glioblastoma multiforme/brain lower grade glioma (GBM/LGG) . This suggests epigenetic regulation may be a significant mechanism controlling GPX8 expression in cancer. To investigate this relationship, researchers should perform bisulfite sequencing of the GPX8 promoter region and correlate methylation patterns with expression levels. The R language and package "ggplot2" can be used to analyze DNA methylation data from TCGA . Treatment of cell lines with demethylating agents like 5-azacytidine followed by GPX8 expression analysis would provide functional validation of this epigenetic control mechanism.

What is the diagnostic value of GPX8 in differentiating cancer from normal tissue?

GPX8 demonstrates significant diagnostic potential across multiple cancer types. Receiver operating characteristic (ROC) curve analysis shows that GPX8 has moderate to high diagnostic accuracy in distinguishing cancer from normal tissue in breast cancer (BRCA), glioblastoma/lower grade glioma (GBM/LGG), head and neck squamous cell carcinoma (HNSC), kidney renal clear cell carcinoma (KIRC), kidney renal papillary cell carcinoma (KIRP), and stomach adenocarcinoma (STAD), with AUCs above 0.7 and even 0.8 . In stomach adenocarcinoma specifically, GPX8 shows good accuracy in distinguishing tumor from normal tissue (AUC = 0.795) and in predicting T stage outcomes (AUC = 0.820) . When evaluating GPX8 as a diagnostic biomarker, researchers should:

  • Compare its performance against established biomarkers

  • Validate findings in independent patient cohorts

  • Consider combining GPX8 with other markers for improved accuracy

How does GPX8 expression correlate with specific clinical and pathological features?

GPX8 expression correlates with several critical clinical and pathological features across cancer types. In GBM/LGG, high GPX8 expression is associated with WHO grade and patient age . In KIRC and STAD, elevated GPX8 expression correlates with T stage and pathologic stage . Univariate analysis shows that high GPX8 expression in stomach cancer has a positive correlation with T stage (OR = 2.032 for T1, T2 vs. T3, T4, P = 0.003), N stage (OR = 2.032 for N1, N2, and N3 vs. N0, P =0.018), and pathologic stage (OR = 3.495 for stage III, stage IV, and stage II vs. stage I, P < 0.001) . These findings indicate that patients with high GPX8 expression tend to present with more advanced disease. Researchers should conduct multivariate analyses to determine if GPX8 is an independent prognostic factor when controlling for these clinical variables.

How can researchers develop and validate GPX8-focused prognostic models?

To develop robust GPX8-based prognostic models, researchers should integrate GPX8 expression data with relevant clinical parameters through the following approach:

  • Perform univariate analysis to identify clinical variables significantly associated with outcomes

  • Conduct multivariate analysis to determine independent prognostic factors

  • Construct a nomogram incorporating GPX8 expression with significant clinical features

  • Validate the model using both internal (bootstrapping) and external patient cohorts

  • Calculate concordance index (C-index) and calibration curves to assess model performance

What is the relationship between GPX8 expression and immune infiltration in the tumor microenvironment?

Research demonstrates a positive correlation between GPX8 expression and immune infiltration in tumors . The TIMER database and single-sample Gene Set Enrichment Analysis (ssGSEA) are valuable tools for evaluating this association. To comprehensively investigate this relationship, researchers should:

  • Perform multiplex immunohistochemistry to visualize spatial relationships between GPX8-expressing cells and immune cell populations

  • Use flow cytometry to quantify immune cell subsets in high vs. low GPX8-expressing tumors

  • Analyze scRNA-seq data to characterize the immune landscape at single-cell resolution

  • Assess the impact of GPX8 modulation on chemokine/cytokine production and immune cell recruitment

  • Evaluate potential correlations between GPX8 expression and response to immunotherapy

Understanding this relationship could reveal new opportunities for combining GPX8-targeted therapies with immunotherapeutic approaches.

What transcription factors regulate GPX8 expression and how can they be experimentally validated?

The QIAGEN database can be used to analyze top transcription factor binding sites in the GPX8 gene promoter . To experimentally validate transcriptional regulation mechanisms, researchers should:

  • Perform promoter analysis using luciferase reporter assays with wild-type and mutated binding sites

  • Conduct chromatin immunoprecipitation (ChIP) to confirm direct binding of candidate transcription factors to the GPX8 promoter

  • Modulate expression of identified transcription factors and assess impact on GPX8 levels

  • Use CRISPR-based approaches to delete specific binding sites and evaluate effects on expression

  • Analyze correlation between transcription factor and GPX8 expression in patient samples

This multi-level validation approach will provide strong evidence for the transcriptional regulation mechanisms controlling GPX8 expression in cancer.

How do signaling pathways converge to regulate GPX8 expression in normal versus cancer cells?

To decipher the signaling networks controlling GPX8 expression, researchers should systematically investigate major cancer-associated pathways:

  • Treat cells with pathway-specific activators and inhibitors (e.g., cytokines, growth factors, small molecule inhibitors)

  • Analyze GPX8 expression changes at mRNA and protein levels

  • Compare pathway dependencies between normal and malignant cells

  • Identify feedback loops between GPX8 and regulatory pathways

  • Perform integrated multi-omics analysis to map the complete regulatory network

Current evidence suggests involvement of the IL-6/STAT3 pathway in GPX8 function , but comprehensive mapping of pathways controlling GPX8 expression remains to be established.

What approaches can be used to target GPX8 for cancer therapy?

Based on the established role of GPX8 in promoting cancer aggressiveness, several therapeutic strategies could be explored:

  • Small molecule inhibitors targeting GPX8 enzymatic activity

  • Monoclonal antibodies against extracellular domains of GPX8

  • RNA interference approaches (siRNA, shRNA) for transient or stable knockdown

  • CRISPR-Cas9 gene editing to disrupt GPX8 expression

  • Peptide inhibitors targeting GPX8 protein-protein interactions

  • Combination approaches targeting both GPX8 and downstream effectors (e.g., STAT3 inhibitors)

Preclinical validation should include assessment of efficacy using both in vitro assays (cell viability, migration, invasion) and in vivo models (xenografts, PDX models), with careful evaluation of potential off-target effects and toxicity profiles.

How might GPX8 expression influence response to standard cancer therapies?

To investigate GPX8's impact on treatment response, researchers should:

  • Compare sensitivity to standard therapies (chemotherapy, radiation, targeted therapy) in isogenic cell lines with modified GPX8 expression

  • Analyze patient datasets for correlations between GPX8 expression and treatment outcomes

  • Evaluate changes in GPX8 expression before and after treatment in patient samples

  • Investigate mechanisms of resistance development in relation to GPX8 expression

  • Assess potential synergistic effects of GPX8 inhibition with established therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.