Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3)

Shipped with Ice Packs
In Stock

Description

Introduction to Human Probable Lipid Phosphate Phosphatase PPAPDC3

Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3) is a human protein encoded by the PPAPDC3 gene, which is also known by alternative names including PLPP7, NET39, and C9orf67 . This gene is located on human chromosome 9q34.13, as confirmed by genomic mapping studies . PPAPDC3 is classified within the PA-phosphatase related phosphoesterase family, suggesting its evolutionary relationship to enzymes involved in phospholipid metabolism . Despite its classification and structural similarity to phosphatases, the protein has been reported to lack detectable enzymatic activity, earning it the descriptor "inactive phospholipid phosphatase 7" in some nomenclature systems .

The full-length human PPAPDC3 protein consists of 271 amino acid residues with a calculated molecular weight of approximately 29,447.3 Daltons and a theoretical isoelectric point (pI) of 10.5, indicating its highly basic nature . This basic characteristic may contribute to its interaction capabilities with other cellular components, particularly those carrying negative charges such as phospholipids and nucleic acids.

Biological Functions of PPAPDC3

Despite lacking detectable enzymatic activity, PPAPDC3 has been identified as having significant biological functions, particularly in muscle tissue. Research has established that PPAPDC3 acts as a negative regulator of myoblast differentiation, a critical process in muscle development and regeneration . This regulatory function appears to be mediated, at least partially, through effects on mechanistic target of rapamycin (MTOR) signaling, previously known as FRAP signaling .

PPAPDC3 has been shown to control MTOR-dependent insulin-like growth factor II (IGF-II) expression during cellular differentiation processes . This suggests that PPAPDC3 operates as an integral component of the regulatory machinery governing myogenesis - the process of muscle tissue formation. The protein's involvement in muscle homeostasis activity has also been suggested by multiple studies, indicating its potential role in maintaining muscle tissue integrity and function over time .

Expression pattern analyses have revealed that PPAPDC3 is highly expressed in cardiac and skeletal muscle tissues, further supporting its specialized role in muscle biology . This tissue-specific expression pattern provides additional evidence for its involvement in muscle-related processes and suggests potential targets for therapeutic interventions involving this protein.

Recombinant PPAPDC3 Production and Properties

Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 can be produced using various expression systems, with Escherichia coli being one of the most commonly employed hosts for this purpose . The recombinant protein is typically expressed with fusion tags to facilitate purification and detection, with the N-terminal histidine (His) tag being particularly common . The full amino acid sequence (residues 1-271) is used for producing the complete functional protein, though partial versions are also available for specific research applications .

The properties of the recombinant PPAPDC3 protein are summarized in the following table:

PropertySpecification
SpeciesHuman
Amino Acid LengthFull Length (1-271)
Expression HostE. coli or Cell-Free Expression
Fusion TagHis (N-terminal)
Physical FormLyophilized powder
Molecular WeightApproximately 29.5 kDa
Theoretical pI10.5
Purity≥85% to ≥90% (SDS-PAGE)
UniProtKB IDQ8NBV4
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

The recombinant protein is typically supplied as a lyophilized powder, which requires reconstitution before use . Manufacturers recommend reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, often with the addition of glycerol (5-50% final concentration) for long-term storage stability . The reconstituted protein demonstrates the expected molecular weight and purity when analyzed by standard biochemical techniques such as SDS-PAGE.

Applications in Research

Recombinant Human PPAPDC3 has numerous applications in biomedical research, particularly in studies focused on muscle development, differentiation, and related pathologies. The availability of purified recombinant protein enables investigators to examine protein-protein interactions, develop antibodies, and establish assay systems for studying PPAPDC3 function.

Researchers have utilized PPAPDC3 in studies investigating the molecular mechanisms of myoblast differentiation and muscle homeostasis . The protein has been employed in experiments examining MTOR signaling pathways and their role in muscle development. Additionally, PPAPDC3 has been studied in the context of its localization to the nuclear envelope, suggesting potential roles in nuclear structure or function .

The development of antibodies against PPAPDC3, facilitated by the availability of recombinant protein, has enabled immunodetection methods including Western blotting, immunofluorescence, and enzyme-linked immunosorbent assays (ELISA) . These techniques allow for the visualization and quantification of PPAPDC3 in various biological samples and experimental systems.

RNA interference techniques targeting PPAPDC3, including small interfering RNA (siRNA) and short hairpin RNA (shRNA), have been developed to investigate the functional consequences of PPAPDC3 knockdown in cellular models . These molecular tools provide valuable insights into the biological roles of PPAPDC3 and its involvement in specific cellular processes.

Future Research Directions

Despite the progress made in characterizing Recombinant Human PPAPDC3, several aspects of this protein remain to be fully elucidated. Future research directions may include detailed structural studies using X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of PPAPDC3, which could provide insights into its function despite lacking enzymatic activity.

Additional studies on the molecular mechanisms through which PPAPDC3 regulates myoblast differentiation and MTOR signaling would enhance our understanding of its biological roles. Investigation of potential binding partners and regulatory networks involving PPAPDC3 may reveal new insights into muscle development and homeostasis.

The potential involvement of PPAPDC3 in human diseases, particularly those affecting muscle tissue, represents another promising area for future research. Alterations in PPAPDC3 expression or function may contribute to the pathogenesis of muscular disorders or other conditions characterized by abnormal muscle development or maintenance.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PLPP7; C9orf67; PPAPDC3; Inactive phospholipid phosphatase 7; Phosphatidic acid phosphatase type 2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PLPP7
Target Protein Sequence
MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG HGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDV LSGFVIGYLQFRLVELVWMPSSTCQMLISAW
Uniprot No.

Target Background

Function
PPAPDC3 serves as a negative regulator of myoblast differentiation, partially through its influence on mTOR signaling. It exhibits no detectable enzymatic activity.
Gene References Into Functions
  1. NET39, a muscle-enriched nuclear envelope transmembrane protein, regulates the initiation of myogenic differentiation by affecting the mTOR-IGF-II pathway. PMID: 19704009
Database Links

HGNC: 28174

KEGG: hsa:84814

UniGene: Hs.134292

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein.

Q&A

What is PPAPDC3 and how is it classified biochemically?

PPAPDC3 (phospholipid phosphatase 7) is a protein-coding gene that belongs to the family of lipid phosphate phosphatases (LPPs). These enzymes catalyze the dephosphorylation of phosphatidate, yielding diacylglycerol and inorganic phosphate . PPAPDC3 is considered "inactive" in its canonical form, as indicated by its full name "phospholipid phosphatase 7 (inactive)" .

Lipid phosphate phosphatases are classified into two major categories based on their cofactor requirements: Mg²⁺-dependent (PAP1) and Mg²⁺-independent (PAP2) enzymes . This classification is important for understanding their cellular localization and functional roles. PPAPDC3 belongs to the broader phosphatase family that includes bacterial acid phosphatases, yeast dihydrosphingosine/phytosphingosine phosphate phosphatase, and mammalian glucose 6-phosphatase among others .

What is the functional significance of PPAPDC3 in lipid metabolism?

While PPAPDC3 is marked as "inactive," it belongs to a family of enzymes that play central roles in lipid metabolism. Lipid phosphate phosphatases generally participate in two major metabolic pathways:

  • Synthesis pathway: The dephosphorylation of phosphatidate (PtdOH) to diacylglycerol (DAG) represents a committed step in the synthesis of triacylglycerol (TAG), which is an important storage lipid . The product DAG is also used in the synthesis of membrane phospholipids including phosphatidylcholine and phosphatidylethanolamine .

  • Signaling pathway: LPPs can generate and/or degrade lipid-signaling molecules related to phosphatidate . They can degrade extracellular lipid phosphates including lysophosphatidic acid (LPA) and sphingosine-1-phosphate (S1P), thereby regulating cellular signaling events .

Understanding PPAPDC3's specific role within these pathways, especially given its classification as "inactive," presents an intriguing research direction for investigators working on lipid metabolism.

How is recombinant PPAPDC3 typically expressed and purified for research applications?

For effective expression and purification of recombinant human PPAPDC3, researchers typically employ the following methodological approach:

  • Vector selection: Appropriate expression vectors such as pcDNA3.1+/C-(K)DYK or customized vectors containing the complete PPAPDC3 open reading frame (ORF) sequence are used . These vectors often contain affinity tags (such as DYKDDDDK/FLAG tag) to facilitate purification.

  • Expression system: Depending on research needs, expression can be performed in prokaryotic systems (E. coli) for high yield but without post-translational modifications, or in eukaryotic systems (mammalian cells like HEK293, insect cells) for proper folding and modifications.

  • Transfection/transformation: For mammalian expression, transfection reagents like lipofectamine are commonly used, while bacterial systems employ heat shock or electroporation methods.

  • Expression conditions: Optimization of temperature, induction time, and media composition is critical for maximizing protein yield while maintaining structural integrity.

  • Purification: Since PPAPDC3 is a membrane-associated protein, solubilization with appropriate detergents followed by affinity chromatography targeting the fusion tag is typically employed, with subsequent size exclusion chromatography for higher purity.

The full ORF sequence of PPAPDC3 (816bp) should be considered when designing expression constructs to ensure complete protein synthesis .

What are the optimal conditions for assaying PPAPDC3 enzymatic activity?

When designing assays for PPAPDC3 enzymatic activity, researchers should consider the following methodological details:

  • Buffer composition: Although PPAPDC3 is labeled as "inactive," related lipid phosphate phosphatases show activity in buffers containing 50-100 mM Tris-HCl (pH 7.5), 1-2 mM DTT or β-mercaptoethanol for maintaining reduced state, and either presence or absence of Mg²⁺ depending on whether the enzyme is PAP1 or PAP2 type .

  • Substrate preparation: Lipid substrates such as phosphatidate should be prepared as vesicles, mixed micelles with Triton X-100, or incorporated into liposomes to ensure accessibility to the membrane-associated enzyme.

  • Reaction conditions: Standard reactions are typically conducted at 30-37°C for 15-30 minutes, with enzyme concentration optimization required to ensure linear reaction rates.

  • Detection methods: Multiple approaches are possible:

    • Colorimetric assay: Measuring released inorganic phosphate

    • Radiometric assay: Using ³²P-labeled substrates

    • Mass spectrometry: For direct detection of lipid products

    • Fluorescence-based assays: Using fluorescent substrate analogs

  • Controls: Include heat-inactivated enzyme, known phosphatase inhibitors, and commercially available phosphatase enzymes as controls.

ParameterTypical Range for LPP AssaysNotes for PPAPDC3 Adaptations
pH6.5-8.0Optimize based on suspected catalytic mechanism
Temperature30-37°CLower temperature may preserve stability
Incubation time10-60 minutesExtended time may be needed for low activity
Substrate concentration0.1-1.0 mMMultiple concentrations for kinetic analysis
Detergent0.1-0.5% Triton X-100Critical for substrate presentation

How can researchers effectively overexpress or knock down PPAPDC3 in cell culture models?

For manipulating PPAPDC3 expression in cell culture models, the following methodological approaches are recommended:

Overexpression approaches:

  • Plasmid-based transient transfection: Using expression vectors containing the PPAPDC3 ORF sequence (816bp) with appropriate promoters (CMV for mammalian cells). Transfection efficiency can be monitored through co-expression of fluorescent markers or through epitope tags fused to PPAPDC3.

  • Stable cell line generation: After transfection, select cells with antibiotics based on the resistance marker in the vector. Single-cell cloning ensures homogeneous expression levels. Inducible systems (Tet-On/Off) allow for controlled expression timing.

  • Viral vectors: Lentiviral or adenoviral systems can be used for cells that are difficult to transfect, achieving higher efficiency and potential for in vivo applications.

Knockdown/knockout approaches:

  • siRNA/shRNA: Design targeting sequences for PPAPDC3 mRNA (typically 19-25 nucleotides). For transient knockdown, siRNA transfection is suitable; for stable knockdown, shRNA expressed from vectors is preferred.

  • CRISPR-Cas9: Design guide RNAs targeting early exons of PPAPDC3. For complete knockout, non-homologous end joining (NHEJ) repair can create frameshift mutations. For precise modifications, homology-directed repair (HDR) with a donor template can be employed.

  • Validation of manipulation: Verify altered expression by:

    • qRT-PCR for mRNA levels

    • Western blotting for protein levels

    • Functional assays to confirm biological impact

A critical consideration is potential compensation by other lipid phosphate phosphatases (LPP1, LPP2, LPP3), which should be monitored during PPAPDC3 manipulation .

What are the key considerations when designing experiments to study PPAPDC3 interactions with other proteins?

When investigating potential protein-protein interactions involving PPAPDC3, researchers should consider these methodological aspects:

  • Experimental design principles:

    • Define clear hypotheses about potential interaction partners based on lipid metabolism pathways

    • Include appropriate controls (negative and positive interaction controls)

    • Consider the membrane-associated nature of PPAPDC3 when designing experiments

    • Account for potential post-translational modifications affecting interactions

  • Recommended interaction detection methods:

    • Co-immunoprecipitation: Using antibodies against PPAPDC3 or epitope tags when working with recombinant protein

    • Proximity ligation assay: For detecting interactions in fixed cells with spatial resolution

    • FRET/BRET: For monitoring interactions in living cells

    • Yeast two-hybrid: May be suitable for cytosolic domains but challenging for full transmembrane proteins

    • Pull-down assays: Using purified recombinant PPAPDC3 as bait

  • Domain-specific considerations:

    • Like other LPPs, PPAPDC3 likely contains transmembrane domains and catalytic regions that may interact differently with partner proteins

    • The second extracellular loop region is of particular interest, as in LPP3 this region contains an RGD motif that interacts with integrins

    • For PPAPDC3, determine if it contains interaction motifs similar to the RGD sequence found in LPP3 or the RGN sequence in LPP1

  • Data analysis and validation:

    • Quantify interaction strength using appropriate statistical methods

    • Validate interactions through multiple independent techniques

    • Confirm biological relevance through functional assays

How does PPAPDC3 differ functionally from other members of the lipid phosphate phosphatase family?

PPAPDC3 displays several distinctive features compared to other lipid phosphate phosphatases, which should be considered in comparative research:

  • Catalytic activity: PPAPDC3 is annotated as "inactive" , suggesting a divergence from the canonical phosphatase function of other family members. This raises intriguing questions about whether it has evolved alternative functions or operates through non-catalytic mechanisms similar to the RGD-mediated integrin binding observed with LPP3 .

  • Substrate specificity: While conventional LPPs show broad substrate preferences for lipid phosphates including LPA, S1P, PA, and C1P , PPAPDC3's specificity profile remains to be fully characterized. Comparative substrate profiling could reveal unique preferences or confirm true catalytic inactivity.

  • Cellular distribution: The subcellular localization of PPAPDC3 may differ from other LPPs, affecting its biological function. While LPP1, LPP2, and LPP3 show plasma membrane localization with their catalytic sites facing extracellularly , PPAPDC3's localization pattern requires investigation.

  • Structural features: Analysis of conserved catalytic domains and transmembrane regions between PPAPDC3 and other LPPs can provide insights into functional divergence. Particular attention should be paid to the C2 phosphatase domain and the three conserved domains required for catalysis in active LPPs .

  • Physiological roles: Unlike LPP3, which is essential for development as evidenced by embryonic lethality in knockout mice , or LPP1, which regulates extracellular lipid signaling , PPAPDC3's physiological significance remains to be established through targeted knockout studies.

Researchers should design comparative experiments to elucidate these differences, potentially revealing whether PPAPDC3 serves as a regulatory protein, has evolved substrate-specific activity, or performs functions independent of phosphatase activity.

What are the strategies for resolving contradictory data regarding PPAPDC3 function in lipid signaling pathways?

When faced with contradictory findings regarding PPAPDC3's role in lipid signaling, researchers should employ these systematic approaches:

  • Meta-analysis of experimental conditions:

    • Create a comprehensive data table comparing all experimental parameters from contradictory studies

    • Identify potential sources of variability including cell types, expression levels, assay conditions, and reagent sources

    • Evaluate the sensitivity and specificity of different detection methods used across studies

  • Standardization of experimental protocols:

    • Develop consistent assay conditions for PPAPDC3 activity measurements

    • Establish reference standards for expression levels in overexpression systems

    • Create a panel of validated cell lines with defined PPAPDC3 expression levels

  • Orthogonal validation approaches:

    • Employ multiple independent techniques to measure the same parameter

    • Combine genetic approaches (knockout/knockdown) with pharmacological interventions

    • Utilize both in vitro reconstituted systems and cellular models

  • Context-dependent function analysis:

    • Systematically evaluate PPAPDC3 function across different cell types and tissue contexts

    • Investigate potential compensatory mechanisms involving other lipid phosphate phosphatases

    • Examine interaction networks in different signaling states

  • Structural and mechanistic investigations:

    • Perform detailed structure-function analysis through mutagenesis of key residues

    • Compare with well-characterized family members like LPP1, LPP2, and LPP3

    • Consider potential allosteric regulation or cofactor requirements

The seemingly contradictory data may reflect genuine biological complexity rather than experimental error. For example, the observation that circulating LPA levels were not significantly decreased in transgenic mice with LPP1 overexpression highlights the complexity of lipid regulation in vivo and suggests that multiple factors, including potential roles for proteins like PPAPDC3, may contribute to homeostasis.

How can advanced imaging techniques be utilized to elucidate PPAPDC3 trafficking and membrane localization?

To investigate PPAPDC3 trafficking and membrane localization, researchers can leverage these advanced imaging methodologies:

  • Super-resolution microscopy approaches:

    • Stimulated Emission Depletion (STED) microscopy: Achieves resolution below 50 nm, allowing visualization of PPAPDC3 localization within membrane microdomains

    • Single-molecule localization microscopy (PALM/STORM): Enables tracking of individual PPAPDC3 molecules with nanometer precision

    • Structured Illumination Microscopy (SIM): Provides ~100 nm resolution for detailed colocalization studies

  • Live-cell imaging strategies:

    • Fluorescent protein fusions: Generate PPAPDC3 constructs with monomeric fluorescent proteins (mEGFP, mCherry) at N- or C-termini, considering possible interference with trafficking signals

    • Photoactivatable or photoconvertible tags: Allow pulse-chase experiments to track newly synthesized pools of PPAPDC3

    • FRAP (Fluorescence Recovery After Photobleaching): Measures lateral mobility and membrane retention of PPAPDC3

  • Correlative microscopy methods:

    • CLEM (Correlative Light and Electron Microscopy): Combines fluorescence imaging of PPAPDC3 with ultrastructural context

    • Immuno-EM: Utilizes gold-labeled antibodies to localize PPAPDC3 at the ultrastructural level

    • FIB-SEM (Focused Ion Beam-Scanning Electron Microscopy): Enables 3D reconstruction of PPAPDC3 distribution

  • Functional imaging approaches:

    • FRET-based biosensors: Monitor PPAPDC3 activity in real-time through sensors that detect phosphatase activity or substrate/product levels

    • Optogenetic tools: Control PPAPDC3 localization or activity through light-inducible domains

    • Engineered peroxidase tags (APEX): Map the PPAPDC3 proximity interactome in situ

  • Quantitative analysis methods:

    • Single-particle tracking: Analyze diffusional behavior and confinement of PPAPDC3

    • Spatial statistics: Apply Ripley's K-function or pair correlation analysis to quantify clustering

    • Machine learning approaches: Implement deep learning for automated detection and classification of trafficking events

Imaging TechniqueResolutionLive/FixedKey Applications for PPAPDC3 Research
Confocal microscopy~200 nmBothGeneral localization and colocalization
STED20-80 nmBothNanoscale organization in membranes
PALM/STORM10-30 nmFixedPrecise molecular distribution patterns
SIM~100 nmBothDynamic redistribution during signaling
TIRF microscopy~100 nm (axial ~100 nm)LiveSurface dynamics and exo/endocytosis
FIB-SEM5-10 nmFixed3D ultrastructural context

What is the evidence linking PPAPDC3 to human disease pathways and potential therapeutic applications?

The connection between PPAPDC3 and human disease remains an emerging area of research, with several lines of evidence warranting further investigation:

  • Lipid metabolism disorders:
    Dysregulation of phospholipid metabolism has been implicated in various metabolic disorders. While direct evidence for PPAPDC3 involvement is limited, other lipid phosphate phosphatases like LPP1 have been linked to conditions such as lipodystrophy through their effects on lipid homeostasis . PPAPDC3, even as an inactive phosphatase, may play regulatory roles in these pathways.

  • Signaling pathway involvement:
    Lipid phosphate phosphatases regulate bioactive lipid mediators that control critical cellular functions including proliferation, migration, and survival . The dysregulation of these lipid mediators, particularly LPA and S1P, has been associated with cancer, inflammation, and fibrosis . PPAPDC3 may influence these signaling networks through protein-protein interactions or regulatory mechanisms.

  • Potential immunomodulatory connections:
    Given that LPP3 can dephosphorylate FTY720-P (fingolimod phosphate), an immunomodulatory drug used in multiple sclerosis treatment , investigation into whether PPAPDC3 interacts with pharmacological agents or endogenous immune modulators could reveal therapeutic implications.

  • Methodological approaches for disease association studies:

    • Genetic association studies: Analyze PPAPDC3 variants in patient cohorts with lipid metabolism disorders

    • Expression profiling: Compare PPAPDC3 expression levels across normal and diseased tissues

    • Functional genomics: Examine the effects of PPAPDC3 manipulation on disease-relevant cellular phenotypes

    • Animal models: Generate tissue-specific PPAPDC3 knockout or transgenic mice to evaluate physiological consequences

  • Therapeutic development considerations:

    • Target validation: Determine if PPAPDC3 modulation affects disease-relevant endpoints

    • Assay development: Establish screening platforms to identify PPAPDC3 interactors

    • Bioinformatic approaches: Utilize structural modeling to identify potential binding pockets for small molecule development

How should researchers address challenges in reproducing PPAPDC3 experimental results across different laboratory settings?

Researchers facing reproducibility challenges with PPAPDC3 studies should implement these methodological strategies:

  • Comprehensive experimental reporting:

    • Document complete methods including cell sources, passage numbers, and growth conditions

    • Specify exact buffer compositions, reagent sources, and lot numbers

    • Report detailed experimental timelines and environmental conditions

    • Publish raw data alongside processed results to enable independent analysis

  • Standardized reagents and protocols:

    • Develop consensus protocols for PPAPDC3 expression, purification, and activity assays

    • Create and share validated tools including expression plasmids, antibodies, and cell lines

    • Establish common positive and negative controls for experimental validation

    • Implement quantitative quality control metrics for reagents and experimental systems

  • Statistical and experimental design considerations:

    • Conduct power analyses to determine appropriate sample sizes

    • Pre-register experimental designs and analysis plans when possible

    • Use randomization and blinding where applicable

    • Implement robust statistical approaches suitable for the data structure

  • Multi-laboratory validation:

    • Establish collaborations for independent replication of key findings

    • Consider ring trials for critical assays and methodologies

    • Develop shared databases of experimental conditions and outcomes

    • Implement sequential validation stages with increasing stringency

  • Data table for tracking experimental variables:

Variable CategorySpecific ParametersDocumentation Approach
Biological materialsCell line, passage number, authentication methodStandard operating procedures with validated quality control
Expression systemsVector, promoter, tags, transfection methodSequence verification and expression level quantification
Assay conditionsBuffer composition, pH, temperature, incubation timeCalibration curves and internal controls
EquipmentInstrument models, settings, calibration statusMaintenance logs and performance verification
Analysis methodsSoftware, algorithms, statistical testsVersion control and analytical validation

What are the most promising research directions for elucidating PPAPDC3's role in cellular phospholipid homeostasis?

Future research into PPAPDC3's function in phospholipid homeostasis should consider these promising directions:

  • Integrated omics approaches:

    • Lipidomics: Profile changes in lipid composition following PPAPDC3 manipulation

    • Proteomics: Identify PPAPDC3 interaction partners and post-translational modifications

    • Transcriptomics: Analyze gene expression changes in response to PPAPDC3 modulation

    • Metabolic flux analysis: Trace labeled lipid precursors to determine PPAPDC3's impact on lipid metabolism kinetics

  • Structural biology investigations:

    • Cryo-EM or X-ray crystallography of PPAPDC3 alone and in complex with potential binding partners

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic structural changes

    • Computational modeling of PPAPDC3 and comparison with active lipid phosphate phosphatases

    • Analysis of potential allosteric sites that could regulate protein-protein interactions

  • Physiological roles in specialized cell types:

    • Investigation in specialized lipid-metabolizing cells (hepatocytes, adipocytes)

    • Analysis of functions in cells with high membrane turnover (neurons, immune cells)

    • Examination of potential roles during cellular stress conditions

    • Evaluation of developmental stage-specific functions

  • Regulatory mechanisms and network integration:

    • Characterization of transcriptional and post-transcriptional regulation

    • Investigation of potential scaffold or adapter functions in signaling complexes

    • Analysis of compensatory mechanisms among lipid phosphate phosphatases

    • Examination of cross-talk with other lipid metabolism pathways

  • Methodological innovations:

    • Development of selective inhibitors or activators of PPAPDC3

    • Generation of conformation-specific antibodies to detect different functional states

    • Creation of biosensors to monitor PPAPDC3-associated lipid dynamics in real-time

    • Application of optogenetic approaches for spatiotemporal control of PPAPDC3 function

Despite being classified as "inactive" , PPAPDC3 may play critical non-enzymatic roles similar to the integrin-binding function observed for LPP3 through its RGD motif . Alternatively, PPAPDC3 might possess cryptic enzymatic activity that manifests only under specific cellular conditions or with particular substrates not yet identified in standard assays.

What consensus findings about PPAPDC3 can guide new researchers entering this field?

New researchers investigating PPAPDC3 should consider these established knowledge points as foundations for their work:

  • PPAPDC3 (phospholipid phosphatase 7) belongs to the lipid phosphate phosphatase family but is classified as enzymatically inactive in its standard form . This classification warrants careful investigation rather than assumption, as activity might depend on specific conditions, substrates, or regulatory mechanisms not yet identified.

  • Like other lipid phosphate phosphatases, PPAPDC3 likely contains conserved structural domains including transmembrane regions and catalytic motifs, though potentially with modifications that affect its enzymatic activity .

  • The lipid phosphate phosphatase family, to which PPAPDC3 belongs, plays crucial roles in both lipid metabolism (synthesis of membrane phospholipids and storage lipids) and cell signaling through regulation of bioactive lipid mediators .

  • Non-catalytic functions, such as the protein-protein interactions demonstrated for LPP3 via its RGD motif , represent potential mechanisms through which PPAPDC3 might exert biological effects despite its classification as inactive.

  • Research approaches for PPAPDC3 should combine molecular techniques (recombinant expression, mutagenesis), cellular studies (localization, trafficking), and systems analysis (effects on lipidome, interactome) to build a comprehensive understanding of its function.

These consensus findings provide an essential framework for developing targeted research questions that address the specific molecular, cellular, and physiological functions of PPAPDC3.

How can collaborative research initiatives accelerate understanding of PPAPDC3 functions?

Strategic collaborative initiatives can significantly advance PPAPDC3 research through these approaches:

  • Multi-disciplinary consortium development:

    • Integrate expertise across biochemistry, cell biology, structural biology, and systems biology

    • Establish core facilities specializing in lipid analysis, protein purification, and imaging

    • Develop shared research objectives and standardized methodologies

    • Implement regular communication channels for data sharing and technique exchange

  • Resource generation and distribution:

    • Create repositories of validated reagents (antibodies, expression constructs, cell lines)

    • Develop and share specialized assay systems for PPAPDC3 research

    • Establish common experimental protocols and quality control standards

    • Generate knockout models and distribute to participating laboratories

  • Integrated data analysis frameworks:

    • Develop centralized databases for experimental results across laboratories

    • Implement machine learning approaches to identify patterns across diverse datasets

    • Create visualization tools for complex lipid metabolism networks

    • Establish computational pipelines for integrating multi-omics data

  • Coordinated research focus areas:

    • Assign specialized research questions to teams with appropriate expertise

    • Develop parallel approaches to address critical knowledge gaps

    • Implement phased research plans with defined milestones

    • Coordinate publication strategies to build coherent literature foundation

  • Training and knowledge dissemination:

    • Organize specialized workshops on techniques relevant to PPAPDC3 research

    • Develop training programs for early-career researchers

    • Create open educational resources on lipid phosphate phosphatase biology

    • Establish annual research symposia focused on PPAPDC3 and related proteins

By coordinating efforts across multiple research groups, the field can rapidly generate the critical mass of data required to understand this enigmatic protein's functions in normal physiology and potential roles in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.