Recombinant Human Probable N-acetyltransferase 8 (NAT8)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Probable N-acetyltransferase 8 (NAT8)

N-acetyltransferase 8 (NAT8), also known as N-acetyltransferase 8 (putative), is a protein encoded by the NAT8 gene in humans . NAT8 is involved in various biological processes, primarily acting as an acetyltransferase . It belongs to the enzyme class of transferases, specifically cysteine-S-conjugate N-acetyltransferases, and acyltransferases .

Basic Information of NAT8

CharacteristicDescription
Gene NameNAT8
AliasesNAT8, ATase2, CML1, GLA, Hcml1, TSC501, TSC510, CCNAT, N-acetyltransferase 8 (putative)
External IDsOMIM: 606716; MGI: 1915646; HomoloGene: 9479; GeneCards: NAT8; OMA: NAT8 - orthologs
EC number2.3.1.80
Molecular FunctionTransferase activity, cysteine-S-conjugate N-acetyltransferase activity, acyltransferase activity, protein binding, lysine N-acetyltransferase activity
Biological FunctionAcetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids, a crucial step in the detoxification of reactive electrophiles . May also have lysine N-acetyltransferase activity, catalyzing peptidyl-lysine N6-acetylation of various proteins .
Predicted PartnersANPEP, LAP3, NAA35, BACE1, KAT2A, KAT2B, PYROXD2, SNRPE, SLC33A1, ALMS1
Involvement in DiseasesChronic kidney disease

Function and Mechanism

NAT8 primarily functions as an N-acetyltransferase, catalyzing the transfer of acetyl groups to various substrates. A key role of NAT8 is in the detoxification pathway, where it acetylates cysteine S-conjugates to form mercapturic acids . This acetylation is the final step in detoxifying a wide array of reactive electrophiles, which are initially incorporated into glutathione S-conjugates. These conjugates are then processed into cysteine S-conjugates, and finally into mercapturic acids, which are water-soluble and easily excreted in urine or bile . NAT8 may also function as a lysine N-acetyltransferase, acetylating proteins on lysine residues .

NAT8 in Kidney Disease

Research indicates a significant association between NAT8 gene variants and chronic kidney disease (CKD) . Specifically, a single nucleotide polymorphism (SNP) rs13538 in the NAT8 gene is frequently reported in association with N-acetylated amino acids, estimated glomerular filtration rate (eGFR), and CKD . Studies involving Black participants with CKD have shown that NAT8-associated metabolites are linked to kidney failure. N-acetylornithine and N-acetyl-1-methylhistidine are associated with lower eGFR and a higher incidence of CKD .

NAT8L (N-Acetyltransferase 8 Like) and Cancer

NAT8L is functionally involved in NAA production in non-small cell lung cancer (NSCLC) . Overexpression of NAT8L in NSCLC leads to increased NAA production, making it a potential circulating biomarker for early detection of lung cancer .

Interactions

NAT8 interacts with several proteins, including:

  • ANPEP (Aminopeptidase N): Involved in peptide digestion and processing .

  • LAP3 (Cytosol aminopeptidase): Involved in intracellular protein turnover .

  • NAA35 (N-alpha-acetyltransferase 35, NatC auxiliary subunit): Part of the N-terminal acetyltransferase C (NatC) complex, which acetylates N-terminal methionine residues .

  • BACE1 (Beta-secretase 1): Involved in proteolytic processing of amyloid precursor protein (APP) .

  • KAT2A (Histone acetyltransferase KAT2A): Acts as a histone lysine succinyltransferase, involved in epigenetic transcription activation .

  • KAT2B (Histone acetyltransferase KAT2B): Functions as a histone acetyltransferase to promote transcriptional activation .

  • SLC33A1 (Acetyl-coenzyme A transporter 1): Probable acetyl-CoA transporter necessary for O-acetylation of gangliosides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
NAT8; CML1; GLA; TSC501; N-acetyltransferase 8; Acetyltransferase 2; ATase2; Camello-like protein 1; Cysteinyl-conjugate N-acetyltransferase; CCNAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
NAT8
Target Protein Sequence
MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL
Uniprot No.

Target Background

Function

Recombinant Human Probable N-acetyltransferase 8 (NAT8) acetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids. This enzyme catalyzes the final step in a major detoxification pathway for various reactive electrophiles. This pathway begins with glutathione S-conjugate formation, followed by processing into cysteine S-conjugates, and finally, the formation of water-soluble mercapturic acids excreted in urine or bile. NAT8 may also exhibit lysine N-acetyltransferase activity, catalyzing peptidyl-lysine N6-acetylation of proteins. This activity potentially regulates apoptosis via acetylation and expression regulation of PROM1. Additionally, NAT8 may regulate amyloid beta-peptide secretion through BACE1 acetylation and expression modulation in neurons.

Gene References Into Functions
  1. The N-acetyltransferase (NAT) pathway plays a significant role in promoting tumor growth and is a promising target for anticancer therapies. PMID: 26819345
  2. ATase1 and ATase2, endoplasmic reticulum-based acetyltransferases, form homo- and heterodimers, associating with components of the oligosaccharyltransferase complex. PMID: 25301944
  3. Biochemical inhibition of ATase1 and ATase2 reduces beta-secretase (BACE1) levels and Abeta generation. PMID: 22267734
  4. NAT8L, the NAA biosynthetic enzyme Asp-N-acetyltransferase, demonstrates high specificity for aspartate acetylation. PMID: 20385109
  5. NAT8 acetylates cysteine S-conjugates to mercapturic acids. PMID: 20392701
  6. Alternative SNPs in the NAT8 upstream region may differentially affect gene expression. PMID: 18402670
Database Links

HGNC: 18069

OMIM: 606716

KEGG: hsa:9027

STRING: 9606.ENSP00000272425

UniGene: Hs.14637

Protein Families
Camello family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Tissue Specificity
Preferentially expressed in liver and kidney. Also detected in brain (at protein level).

Q&A

What is the primary enzymatic function of human NAT8?

Human NAT8 functions as cysteinyl-S-conjugate N-acetyltransferase (CCNAT), catalyzing the final step in mercapturic acid formation. The enzyme specifically N-acetylates cysteine S-conjugates, such as S-benzyl-L-cysteine and leukotriene E4, but shows no activity toward other physiological amines or amino acids. This activity places NAT8 in the xenobiotic metabolism pathway, particularly in detoxification processes occurring in liver and kidney .

Research methodology for confirming this function typically involves:

  • Expressing recombinant NAT8 in cell lines (typically HEK293T)

  • Conducting enzyme activity assays using various potential substrates

  • Analyzing reaction products via HPLC and mass spectrometry

  • Measuring kinetic parameters under varying substrate concentrations

How does NAT8 differ from its homologue NAT8L?

While NAT8 and NAT8L share approximately 30% sequence identity, they differ significantly in structure, tissue expression, and function. Key differences include:

FeatureNAT8NAT8L
Amino acid length~230 residues~300 residues
N-terminal regionLacks conserved 20-aa sequenceContains conserved sequence and Pro-Gly rich regions
Tissue expressionPrimarily kidney and liverPredominantly brain
Enzymatic functionCysteinyl-S-conjugate N-acetyltransferaseAspartate N-acetyltransferase (produces N-acetylaspartate)
Substrate specificityCysteine S-conjugatesAspartate

Both enzymes share a hydrophobic domain that anchors them to membranes and a C-terminal region that likely contains most of the catalytic site. Research comparing these homologues typically involves protein sequence alignment, expression pattern analysis, and comparative enzymatic activity assays .

What is the relationship between NAT8 and NAT8B in humans?

The study of pseudogenes like NAT8B provides insights into evolutionary processes affecting xenobiotic metabolism enzymes, which are often found as multiple, tandemly repeated genes in vertebrate genomes.

What are the recommended methods for expressing and analyzing recombinant human NAT8?

Successful expression and analysis of recombinant human NAT8 requires careful consideration of its membrane-bound nature. Recommended methodological approaches include:

  • Expression system selection: HEK293T cells have proven effective for NAT8 expression, maintaining proper protein folding and membrane association.

  • Vector design considerations:

    • Using eukaryotic vectors with N-terminal (pEF6-NAT8) or C-terminal (pEF6/Myc-NAT8) His-tags

    • Including appropriate signal sequences for membrane targeting

    • Considering potential toxicity effects during extended expression periods

  • Activity assay design:

    • Using radiochemical assays with [acetyl-³H]CoA for high sensitivity

    • Including detergent optimization (1mM octyl glucoside slightly stimulates activity while higher concentrations inhibit)

    • Employing HPLC separation with mass spectrometry confirmation

    • Using S-benzyl-L-cysteine as a primary substrate for standardization

  • Protein detection:

    • Western blotting with anti-tag antibodies

    • Confocal microscopy for subcellular localization studies

How should researchers approach kinetic characterization of NAT8?

Kinetic characterization of NAT8 requires careful consideration of its membrane association and detergent sensitivity. Based on research findings, a methodological approach should include:

  • Preparation of cell extracts:

    • Using transfected HEK293T cells expressing tagged NAT8

    • Avoiding purification steps using detergents that may inactivate the enzyme

    • Working with crude cell extracts for kinetic studies

  • Kinetic parameter determination:

    • Measuring activity across a range of substrate concentrations

    • For S-benzyl-L-cysteine: Testing around the Km of 64±16 μM

    • For acetyl-CoA: Testing around the Km of 23±13 μM

    • Using acetyl-CoA at 0.2mM for substrate variation studies

    • Using S-benzyl-L-cysteine at 0.5mM for acetyl-CoA variation studies

  • Data analysis:

    • Employing Michaelis-Menten kinetics calculations

    • Normalizing to protein concentration in extracts

    • Presenting data as nmol·min⁻¹·mg⁻¹ protein

What considerations are important when studying NAT8 subcellular localization?

Accurate determination of NAT8 subcellular localization requires careful experimental design:

  • Cell model selection:

    • Chinese hamster ovary (CHO) cells have been successfully used

    • HEK293T cells provide a viable alternative

  • Visualization techniques:

    • Double immunolabeling using anti-tag antibodies (anti-Myc or anti-poly-His)

    • Co-staining with organelle markers:

      • KDEL-bearing proteins for ER

      • GM130 for Golgi complex

      • MitoTracker red for mitochondria

  • Critical analysis considerations:

    • Examining nuclear envelope delineation

    • Identifying reticular patterns characteristic of ER

    • Confirming continuities with the nuclear envelope

    • Recognizing that co-localization with ER markers may not be complete due to ER domain heterogeneity

  • Comparative approaches:

    • Direct comparison with NAT8L localization patterns when studying membrane association mechanisms

    • Using affinity-purified antibodies that don't cross-react for specificity

How do common polymorphisms affect NAT8 enzymatic activity?

Research on NAT8 has identified two common single nucleotide polymorphisms (SNPs): E104K and F143S. Methodologically sound approaches to studying these variants include:

  • Generation of mutant constructs:

    • Site-directed mutagenesis of wild-type NAT8 expression vectors

    • Verification of mutations by sequencing

  • Comparative activity analysis:

    • Expression of wild-type and mutant proteins under identical conditions

    • Normalization of activity to protein expression levels

    • Standardized substrate and assay conditions

Results indicate that neither E104K nor F143S significantly alters enzymatic activity or protein expression (changes less than 2-fold). In contrast, mutation of the highly conserved arginine at position 149 (R149K) completely abolishes enzymatic activity .

This methodological approach can be extended to study other NAT8 variants of interest, including:

  • Newly identified polymorphisms

  • Species-specific variations

  • Designed mutations to probe structure-function relationships

What experimental approaches can identify NAT8 structural determinants of activity?

Understanding the structure-function relationship of NAT8 requires systematic investigation of its domains:

  • Domain analysis methodology:

    • Creating truncated constructs (as demonstrated with Met-25 initiated proteins)

    • Developing chimeric proteins between NAT8 and NAT8L to identify substrate specificity determinants

    • Site-directed mutagenesis of conserved residues (like R149)

  • Structural elements to consider:

    • The hydrophobic stretch (~30 residues) responsible for membrane anchoring

    • The C-terminal region (~120 residues) that likely contains most of the catalytic site

    • The conserved region of ~30 residues preceding the hydrophobic domain

  • Functional testing:

    • Enzymatic activity assays with model substrates

    • Subcellular localization studies

    • Protein stability assessment

The research shows that truncation from the N-terminus (starting at Met-25) abolishes CCNAT activity, highlighting the importance of the N-terminal region for function .

What data explains the toxicity associated with NAT8 overexpression?

NAT8 overexpression has been shown to induce cellular toxicity, which can be methodically investigated through:

  • Toxicity assessment approaches:

    • Quantitative measurement of lactate dehydrogenase release

    • Time-course analysis (24h vs. 48h post-transfection)

    • Comparison of wild-type and mutant constructs

  • Key findings:

    • Wild-type NAT8, E104K variant, and catalytically inactive R149K mutant all induce similar toxicity

    • Effects become more pronounced at 48h compared to 24h post-transfection

    • Toxicity appears independent of enzymatic activity since the inactive R149K mutant retains toxicity

  • Mechanistic investigation strategies:

    • Protein overload analysis in the ER

    • Assessment of unfolded protein response markers

    • Examination of apoptotic pathways

These observations align with previous studies showing that mRNAs from human, mouse, or Xenopus NAT8 homologues induced toxicity when injected into Xenopus embryos, suggesting a conserved mechanism.

How can NAT8 be utilized in xenobiotic metabolism research?

NAT8's function as cysteinyl-S-conjugate N-acetyltransferase makes it valuable for xenobiotic metabolism studies:

  • Experimental approaches for drug metabolism investigation:

    • Transfection systems for controlled NAT8 expression

    • Cell-based assays to test acetylation of pharmaceutical compounds

    • Mass spectrometry analysis of metabolite formation

    • In vitro-in vivo correlation studies

  • Applications in toxicology:

    • Using NAT8 activity as a biomarker for organ-specific toxicity

    • Assessing role in detoxification versus bioactivation of xenobiotics

    • Determining species differences in drug metabolism

  • Methodological considerations:

    • Using physiologically relevant expression levels

    • Including appropriate co-factors (acetyl-CoA)

    • Testing multiple substrate concentrations to determine kinetic parameters

    • Considering the influence of the membrane environment

What approaches are recommended for studying NAT8 in the context of disease models?

Given NAT8's involvement in mercapturic acid formation and xenobiotic metabolism, several methodological approaches can be employed for disease-related research:

  • Kidney and liver disease models:

    • Creating tissue-specific NAT8 knockout or overexpression models

    • Investigating changes in NAT8 expression during disease progression

    • Assessing the impact of altered NAT8 function on toxicant clearance

  • Drug-induced injury studies:

    • Modulating NAT8 expression/activity before toxicant exposure

    • Measuring mercapturic acid formation as a biomarker

    • Correlating NAT8 polymorphisms with susceptibility to drug-induced injury

  • Analytical techniques:

    • Gene expression analysis in patient samples

    • Metabolomics approaches to quantify mercapturic acids

    • Enzyme activity assays in disease-relevant primary cells

This research should build upon NAT8's established role in cysteinyl-S-conjugate N-acetylation and its primary expression in kidney and liver tissues .

How can researchers functionally differentiate between NAT8 and related enzymes?

To establish specificity when studying NAT8 among related N-acetyltransferases, researchers should employ multiple differentiation strategies:

  • Substrate profiling methodology:

    • Testing NAT8 against substrates of other NATs

    • Using S-benzyl-L-cysteine as a positive control

    • Including negative controls (substrates for NAT8L and other acetyltransferases)

    • Comprehensive LC-MS/MS detection of acetylated products

  • Expression pattern analysis:

    • Tissue-specific expression profiling (focus on kidney and liver)

    • Comparing with other NATs' expression patterns

    • Using specific antibodies that don't cross-react with homologous proteins

  • Inhibitor sensitivity studies:

    • Developing selective inhibitors based on structural differences

    • Testing detergent sensitivity (octyl glucoside at varying concentrations)

    • Comparative inhibition profiles across the NAT family

  • Subcellular localization:

    • Confirming ER association through co-localization studies

    • Distinguishing from other cellular compartments (Golgi, mitochondria)

    • Comparing with the similar but distinct localization pattern of NAT8L

What strategies can overcome challenges in NAT8 expression and activity preservation?

NAT8's membrane association and sensitivity to detergents present specific challenges that can be addressed through:

  • Optimizing expression systems:

    • Using mammalian cells (HEK293T) rather than bacterial systems

    • Considering inducible expression systems to minimize toxicity

    • Testing different tag positions (N-terminal vs. C-terminal)

  • Activity preservation approaches:

    • Avoiding detergents during purification (use crude cell extracts)

    • When detergents are necessary, maintaining octyl glucoside at low concentrations (1mM)

    • Avoiding CHAPS and Triton X-100 which showed inhibitory effects

    • Considering membrane fraction isolation methods that preserve native environment

  • Storage considerations:

    • Determining optimal buffer compositions

    • Evaluating freezing/thawing effects on activity

    • Adding stabilizing agents where appropriate

How should researchers address the potential cytotoxicity of NAT8 in experimental systems?

The observed toxicity of NAT8 overexpression requires methodological considerations:

  • Experimental design adaptations:

    • Implementing time-course studies to capture data before significant toxicity (24h rather than 48h)

    • Using inducible expression systems for temporal control

    • Testing expression levels to find a balance between detection and toxicity

  • Toxicity assessment methods:

    • Lactate dehydrogenase release quantification

    • Cell viability assays (MTT, resazurin)

    • Apoptosis markers (caspase activation, annexin V)

    • Unfolded protein response monitoring

  • Control strategies:

    • Including appropriate vehicle controls

    • Using catalytically inactive mutants (R149K) to distinguish activity-dependent effects from expression-related toxicity

    • Employing other membrane proteins as controls for ER stress responses

What methodological considerations are important when interpreting NAT8 activity in complex biological samples?

Analyzing NAT8 in tissue samples or complex biological matrices requires careful methodological approaches:

  • Sample preparation considerations:

    • Preserving membrane integrity during tissue homogenization

    • Separating NAT8 activity from other N-acetyltransferases

    • Accounting for potential inhibitors in biological matrices

  • Analytical specificity strategies:

    • Using highly specific substrates (S-benzyl-L-cysteine)

    • Employing selective antibodies for immunoprecipitation

    • Including appropriate controls (tissues from different expression levels)

  • Data interpretation frameworks:

    • Normalizing to expression levels determined by Western blotting

    • Considering the influence of common polymorphisms (E104K, F143S)

    • Accounting for potential species differences when using animal models

    • Recognizing that NAT8B does not contribute functional activity in humans

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.