Recombinant Human Probable palmitoyltransferase ZDHHC11B (ZDHHC11B)

Shipped with Ice Packs
In Stock

Description

Introduction to ZDHHC11B

ZDHHC11B (zinc finger DHHC-type containing 11B) is a putative palmitoyltransferase belonging to the DHHC palmitoyltransferase family. These enzymes catalyze the post-translational modification of proteins through the addition of palmitate groups, influencing membrane localization, stability, and signaling . Recombinant ZDHHC11B refers to the purified, overexpressed form of this protein, commonly used in biochemical and cellular studies to investigate its enzymatic activity, interactions, and functional roles.

Tumorigenesis and Epithelial–Mesenchymal Transition (EMT)

Studies in lung adenocarcinoma (LUAD) reveal ZDHHC11B as a tumor suppressor:

  • Expression Patterns: ZDHHC11B levels are significantly reduced in LUAD tissues compared to normal lung tissue .

  • Mechanistic Insights:

    • EMT Inhibition: Overexpression of ZDHHC11B suppresses EMT markers (e.g., vimentin, N-cadherin) and promotes epithelial markers (e.g., E-cadherin) .

    • Apoptosis and Proliferation: ZDHHC11B induces apoptosis and inhibits migration/invasion in LUAD cell lines (e.g., A549) .

AssayZDHHC11B OverexpressionZDHHC11B Knockdown
Proliferation↓ (Inhibition) ↑ (Promotion)
Migration
Apoptosis

Potential Involvement in NF-κB Signaling

While ZDHHC11 (a homolog) enhances NF-κB activation by interacting with TRAF6 and promoting K63-linked ubiquitination , direct evidence for ZDHHC11B in this pathway is lacking. Further studies are needed to confirm its role in immune or inflammatory responses.

Cancer Research

  • LUAD Model Studies: In vivo tumor xenograft models demonstrate reduced tumor growth with ZDHHC11B overexpression .

  • Prognostic Potential: ZDHHC11B downregulation correlates with poor prognosis in LUAD, suggesting its utility as a biomarker .

Recombinant Protein Applications

ApplicationDetailsMethod
Enzymatic AssaysTesting palmitoyltransferase activity in vitroWestern Blot
Antibody ValidationConfirming specificity of anti-ZDHHC11B antibodies (e.g., in IHC/WB)Western Blot
Interaction StudiesIdentifying substrate proteins or interactors (e.g., TRAF6 analogs)Co-IP, Pull-Down

Challenges and Future Directions

  • Enzymatic Activity: Direct evidence of ZDHHC11B’s palmitoyltransferase activity remains unconfirmed, necessitating biochemical assays .

  • Therapeutic Targets: While ZDHHC11B shows promise in LUAD, its role in other cancers and inflammatory diseases requires exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZDHHC11B; Probable palmitoyltransferase ZDHHC11B; Zinc finger DHHC domain-containing protein 11B; DHHC-11B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC11B
Target Protein Sequence
MDTRSGSQCSVTPEAIRNNEELVLPPRISRVNGWSLPLHYFRVVTWAVFVGLSLATFRIF IPLLPHSWKYIAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAH VIQNQFCHLCKVTVNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAG MLCLIAILLYVLVQYLVNPRVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIRMLV LLLDLLGLVQLGQLLIFHIYLKAKKMTTFEYLINTRKEESSKHQAVRKDPYVQMDKGFLQ QGAGALGSSAQGVKAKSSLLIYKCPCHFCTSVNQDGDSKAQEADDAPSTSTLGLQQETTE PMKTDSAESED
Uniprot No.

Target Background

Function

Recombinant Human Probable palmitoyltransferase ZDHHC11B (ZDHHC11B) is a probable palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It is implicated in diverse cellular processes and may play a role in cell proliferation.

Database Links

HGNC: 32962

STRING: 9606.ENSP00000442373

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and classification of ZDHHC11B?

ZDHHC11B is a human protein belonging to the DHHC palmitoyltransferase family. It consists of 371 amino acids with a molecular mass of approximately 41.9 kDa. The protein contains the characteristic DHHC domain common to palmitoyltransferases, which is crucial for its enzymatic activity . Unlike many other proteins, ZDHHC11B should not be abbreviated further to maintain scientific clarity in research documentation.

How does ZDHHC11B differ from ZDHHC11?

Though similarly named, ZDHHC11B and ZDHHC11 demonstrate distinct functional properties. While ZDHHC11 positively regulates NF-κB signaling by enhancing TRAF6 oligomerization and E3 ligase activity , ZDHHC11B appears to exhibit tumor-suppressive properties by inhibiting processes like epithelial-mesenchymal transition (EMT) . Understanding these differences is critical when designing experiments targeting either protein specifically.

What is the subcellular localization of ZDHHC11B?

Based on structural analysis and protein family characteristics, ZDHHC11B likely localizes to cellular membranes, similar to other DHHC family proteins. Experimental verification using subcellular fractionation and immunofluorescence microscopy with specific antibodies would be recommended to confirm its precise localization, which may provide insights into its functional mechanisms.

What are the optimal expression systems for producing recombinant ZDHHC11B?

For recombinant expression of ZDHHC11B, mammalian expression systems are generally preferred to ensure proper post-translational modifications and folding. HEK293T cells have been successfully used for expressing related DHHC family proteins . When designing expression constructs, researchers should consider adding epitope tags (such as FLAG or Myc) that do not interfere with the DHHC domain to facilitate detection and purification while preserving enzymatic activity.

How can ZDHHC11B activity be measured in experimental settings?

Palmitoyltransferase activity can be assessed using various approaches:

  • Metabolic labeling: Incorporating palmitoyl-CoA analogs followed by click chemistry detection

  • Acyl-biotin exchange (ABE): Involves multiple chemical steps to exchange thioester-linked palmitate with biotin

  • In vitro enzymatic assays: Using purified recombinant ZDHHC11B with fluorescent palmitoyl-CoA substrates

Each method has specific advantages and limitations that should be considered based on research objectives and available resources.

What are effective approaches for studying ZDHHC11B in cancer models?

Based on recent findings, several methodological approaches have proven valuable:

  • Gene knockdown/knockout: Using siRNA, shRNA, or CRISPR-Cas9 systems to modulate ZDHHC11B expression

  • Overexpression studies: Transfecting cell lines with ZDHHC11B expression vectors

  • Xenograft models: Injecting modified cancer cells into nude mice to study tumor growth in vivo

  • Patient-derived samples: Analyzing ZDHHC11B expression in clinical specimens compared to normal tissues

These approaches can be combined with functional assays measuring proliferation, migration, invasion, and apoptosis to comprehensively evaluate ZDHHC11B's role in cancer progression.

What are the known substrates of ZDHHC11B?

Current research has not definitively identified specific substrates of ZDHHC11B. Identification of these substrates represents a critical research gap. Researchers should consider employing:

  • Proximity-based labeling techniques (BioID, APEX)

  • Co-immunoprecipitation followed by mass spectrometry

  • Palmitoylation proteomics comparing wild-type and ZDHHC11B-deficient cells

These approaches would help establish the substrate specificity of ZDHHC11B and elucidate its functional network.

How does ZDHHC11B affect cellular signaling pathways?

Research indicates that ZDHHC11B may influence epithelial-mesenchymal transition (EMT) pathways. Gene Set Enrichment Analysis (GSEA) has revealed positive correlations between ZDHHC11B expression and EMT processes . This suggests that ZDHHC11B might regulate proteins involved in cell adhesion, cytoskeletal reorganization, or transcriptional regulation of EMT-related genes.

What role does ZDHHC11B play in protein trafficking and membrane localization?

As a member of the palmitoyltransferase family, ZDHHC11B likely influences protein trafficking and membrane localization through palmitoylation of target proteins. This post-translational modification increases protein hydrophobicity, facilitating membrane association and potentially influencing protein-protein interactions. Experimental approaches using palmitoylation-deficient mutants of candidate substrate proteins would help elucidate these functions.

What evidence supports ZDHHC11B's role as a tumor suppressor?

Multiple lines of evidence support ZDHHC11B's tumor-suppressive role:

  • Decreased expression: ZDHHC11B is downregulated in lung adenocarcinoma (LUAD) compared to normal tissues

  • Functional studies: Overexpression of ZDHHC11B inhibits proliferation, migration, and invasion of LUAD cells

  • Apoptosis induction: ZDHHC11B induces apoptosis in LUAD cells

  • In vivo effects: ZDHHC11B inhibits tumor growth in nude mice

These findings collectively suggest that ZDHHC11B functions as a tumor suppressor, particularly in lung adenocarcinoma.

How does ZDHHC11B influence epithelial-mesenchymal transition (EMT) in cancer?

ZDHHC11B expression shows positive correlation with EMT processes according to GSEA analysis . This suggests that ZDHHC11B may regulate key proteins involved in maintaining epithelial phenotypes or suppressing mesenchymal transitions. Researchers investigating this relationship should examine:

  • Expression of epithelial markers (E-cadherin, ZO-1) and mesenchymal markers (N-cadherin, Vimentin, Snail, Slug) in response to ZDHHC11B modulation

  • Changes in cell morphology and cytoskeletal organization

  • Effects on cell-cell adhesion and matrix interaction

  • Transcriptional regulation of EMT-related genes

What are the differences in ZDHHC11B expression across different cancer types?

  • Mining cancer genomics databases (TCGA, ICGC)

  • Performing immunohistochemistry on tissue microarrays representing multiple cancer types

  • Analyzing single-cell RNA sequencing data to understand expression heterogeneity within tumors

This would help establish whether ZDHHC11B's tumor-suppressive role extends beyond lung cancer.

How does ZDHHC11B function compare to ZDHHC11?

Despite sequence similarities, ZDHHC11B and ZDHHC11 appear to have distinct and potentially opposing functions:

FeatureZDHHC11ZDHHC11B
Effect on signalingPositively regulates NF-κB signaling May inhibit pathways involved in tumorigenesis
Role in cancerMay promote cancer development through NF-κB activation Appears to suppress tumor growth and progression
Molecular interactionsAssociates with TRAF6, enhancing its oligomerization and E3 activity Specific interactions not yet fully characterized
Response to stimuliInvolved in NF-κB activation induced by IL-1β, LPS, and DNA virus infection Relationship to inflammatory stimuli not yet defined

This comparison highlights the importance of distinguishing between these proteins in experimental designs and interpretations.

What evolutionary insights can be gained from studying ZDHHC11B across species?

Comparative genomics and phylogenetic analysis of ZDHHC11B across species could provide insights into its evolutionary conservation and functional importance. Researchers should consider:

  • Sequence homology analysis across vertebrates and invertebrates

  • Identification of conserved domains and motifs

  • Analysis of selection pressure on different regions of the protein

  • Correlation of evolutionary conservation with known functional domains

This evolutionary perspective may highlight critically important regions for functional studies.

What are the main challenges in generating specific antibodies against ZDHHC11B?

Developing specific antibodies for ZDHHC11B presents several challenges:

  • Potential cross-reactivity with ZDHHC11 due to sequence similarity

  • Hydrophobic nature of the protein may limit accessibility of epitopes

  • Post-translational modifications might affect antibody recognition

To overcome these challenges, researchers should:

  • Target unique regions that differentiate ZDHHC11B from other DHHC family members

  • Consider developing monoclonal antibodies with extensively validated specificity

  • Employ epitope tags in recombinant systems when studying overexpression

How can researchers address inconsistent results in ZDHHC11B functional studies?

Inconsistencies in functional studies may arise from:

  • Cell type-specific effects

  • Variations in experimental conditions

  • Differences in ZDHHC11B expression levels

  • Cross-talk with other signaling pathways

To enhance reproducibility, researchers should:

  • Clearly document experimental conditions and cell passage numbers

  • Validate ZDHHC11B expression levels across experiments

  • Use multiple cell lines to confirm observations

  • Employ both gain-of-function and loss-of-function approaches

  • Validate key findings with complementary techniques

What are promising therapeutic approaches targeting ZDHHC11B in cancer?

Given ZDHHC11B's apparent tumor-suppressive role, several therapeutic strategies merit investigation:

  • Gene therapy approaches: Restoring ZDHHC11B expression in tumors where it is downregulated

  • Small molecule modulators: Developing compounds that enhance ZDHHC11B enzymatic activity

  • Substrate-targeted approaches: Identifying and targeting key substrates of ZDHHC11B

  • Combination therapies: Exploring synergistic effects with established cancer treatments

Preclinical evaluation would need to assess efficacy, specificity, and potential off-target effects of these approaches.

What research gaps need to be addressed to better understand ZDHHC11B biology?

Several critical knowledge gaps require attention:

  • Identification of specific ZDHHC11B substrates

  • Elucidation of regulatory mechanisms controlling ZDHHC11B expression and activity

  • Determination of three-dimensional structure

  • Understanding of tissue-specific functions

  • Clarification of roles in non-cancer biological processes

  • Investigation of potential interactions with other post-translational modification systems

Addressing these gaps would significantly advance understanding of ZDHHC11B biology and its therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.