Recombinant Human Probable palmitoyltransferase ZDHHC12 (ZDHHC12)

Shipped with Ice Packs
In Stock

Description

Introduction to ZDHHC12

Recombinant Human Probable Palmitoyltransferase ZDHHC12 (ZDHHC12) is a genetically engineered enzyme belonging to the zinc finger DHHC-type palmitoyltransferase family. It catalyzes protein S-palmitoylation, a reversible post-translational modification involving the covalent attachment of palmitate (a 16-carbon fatty acid) to cysteine residues of target proteins. This modification regulates protein localization, stability, and interactions, impacting cellular signaling, membrane trafficking, and disease pathogenesis . ZDHHC12 is encoded by the ZDHHC12 gene located on chromosome 9q34.11 and exists in three isoforms due to alternative splicing .

Catalytic Mechanism

ZDHHC12 follows a two-step enzymatic process:

  1. Autoacylation: The DHHC motif’s cysteine residue is auto-palmitoylated using palmitoyl-CoA as a substrate.

  2. Substrate Transfer: The palmitoyl group is transferred to a cysteine residue on the target protein .

Cancer

ZDHHC12 is implicated in multiple cancers due to its regulatory roles in redox balance, mitochondrial function, and drug resistance:

Cancer TypeKey FindingsReferences
Ovarian Cancer- ZDHHC12 enhances cisplatin resistance by regulating mitochondrial ROS homeostasis .
- Knockdown of ZDHHC12 increases ROS, ATP levels, and mitochondrial activity, sensitizing cells to cisplatin .
Glioma- Hypomethylation-induced ZDHHC12 overexpression promotes proliferation, migration, and invasion .
- Correlates with poor prognosis in high-grade gliomas .
Pancreatic Cancer- ZDHHC9 (a homolog) modifies tumor microenvironments, suggesting potential parallel roles for ZDHHC12 .

Neurological Disorders

  • ZDHHC12-mediated palmitoylation regulates synaptic proteins (e.g., AMPA receptors) and neuronal signaling .

  • Dysregulation is linked to schizophrenia (SCZ) and intellectual disability (ID) .

Research Tools: Recombinant ZDHHC12

Recombinant ZDHHC12 is widely used to study palmitoylation mechanisms and disease pathways. Key applications include:

ApplicationDetailsReferences
Western BlotDetects endogenous ZDHHC12 in human cell lines (e.g., A431, SNU119) with high specificity .
Functional Studies- siRNA knockdown models reveal ZDHHC12’s role in mitochondrial ROS regulation .
- Overexpression assays assess its impact on protein stability (e.g., CLDN3 in ovarian cancer) .
Therapeutic ScreeningUsed to evaluate inhibitors (e.g., 2-bromopalmitate) targeting palmitoylation in cancer .

Targeting ZDHHC12 in Cancer

  • Cisplatin Synergy: Inhibiting ZDHHC12 with siRNA or pharmacological agents (e.g., 2BP) enhances cisplatin efficacy in ovarian cancer by disrupting redox balance .

  • Mitochondrial Regulation: ZDHHC12 knockdown increases mitochondrial mass and ATP production, suggesting dual roles in metabolism and apoptosis .

Neurological Applications

  • Modulating ZDHHC12 activity may restore synaptic plasticity in disorders like SCZ by regulating palmitoylated receptors .

Research Challenges and Future Directions

  1. Substrate Specificity: ZDHHC12’s target repertoire remains poorly defined. Proteomic studies are needed to identify novel substrates .

  2. Structural Insights: High-resolution structures of ZDHHC12 could guide inhibitor design .

  3. Clinical Translation: Preclinical models (e.g., organoids) must validate ZDHHC12 targeting in vivo .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC12; ZNF400; PSEC0008; Palmitoyltransferase ZDHHC12; DHHC domain-containing cysteine-rich protein 12; DHHC-12; Zinc finger DHHC domain-containing protein 12; Zinc finger protein 400
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC12
Target Protein Sequence
MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLL YLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCV RRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLL FATFLLLSLFSLVASLLLVSHLYLVASNTTTWEFISSHRIAYLRQRPSNPFDRGLTRNLA HFFCGWPSGSWETLWAEEEEEGSSPAV
Uniprot No.

Target Background

Function
ZDHHC12 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It exhibits palmitoyltransferase activity toward gephyrin/GPHN, regulating its clustering at synapses and its role in gamma-aminobutyric acid receptor clustering. Consequently, it indirectly regulates GABAergic synaptic transmission.
Database Links

HGNC: 19159

KEGG: hsa:84885

STRING: 9606.ENSP00000361748

UniGene: Hs.133122

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is ZDHHC12 and what is its fundamental cellular function?

ZDHHC12 is a palmitoyl transferase enzyme involved in protein palmitoylation, a critical post-translational modification. This enzyme plays a key role in the regulation of protein localization, stability, and function through the addition of palmitate groups to protein substrates . ZDHHC12 belongs to the ZDHHC family of genes, which in mammals consists of 23 members . The enzyme contains the characteristic Asp-His-His-Cys (DHHC) catalytic domain responsible for its palmitoyltransferase activity. Dysregulation of palmitoylation has been associated with various diseases, including cancer, neurological disorders, and metabolic conditions . Understanding ZDHHC12 function is essential for unraveling the molecular mechanisms underlying these pathologies.

What methodological approaches are most effective for detecting and measuring ZDHHC12 in experimental systems?

Several methodologies are available for researchers to detect and analyze ZDHHC12:

TechniqueApplicationRecommended ParametersAdvantages
Western blotProtein detectionDilution 1:500-1:2000Quantitative analysis of expression levels
ELISAProtein quantificationDilution 1:2000-1:10000High-throughput screening
ImmunohistochemistryTissue localizationDilution 1:20-1:200In situ visualization
ImmunofluorescenceSubcellular localizationDilution 1:50-1:200Co-localization studies

For optimal results, researchers should use antibodies targeting recombinant human ZDHHC12 protein, particularly the region spanning amino acids 121-197 . The ZDHHC12 Polyclonal Antibody exhibits high specificity and sensitivity towards human samples and has been validated for multiple applications. Preservation in 0.03% Proclin 300 with 50% Glycerol and 0.01M PBS (pH 7.4) maintains antibody stability and function .

What structural features and domains characterize the ZDHHC12 protein?

ZDHHC12 contains the signature DHHC domain that defines this family of palmitoyltransferases. The catalytic cysteine at position 127 is critical for enzymatic activity, as demonstrated by the loss of function in the C127S mutant . This residue is essential for the transfer of palmitate groups to substrate proteins. The protein's structural organization allows for specific substrate recognition and catalytic efficiency. Mutation studies have confirmed that the C127S substitution abolishes palmitoyltransferase activity while maintaining protein-protein interactions, making this mutation valuable for mechanistic studies of ZDHHC12 function .

What are the known substrate proteins of ZDHHC12 and how does it regulate their function?

Current research has identified claudin-3 (CLDN3) as a key substrate of ZDHHC12. The enzyme mediates S-palmitoylation of CLDN3 specifically at cysteine residues 181, 182, and 184 in the C-terminus region . This post-translational modification is critical for:

  • Proper membrane localization of CLDN3

  • Maintaining CLDN3 protein stability

  • Supporting CLDN3's function in cell signaling

Experimental evidence demonstrates that co-expression of wild-type ZDHHC12 with CLDN3 increases the S-palmitoylation level of CLDN3 by approximately 1.40-fold compared to cells expressing CLDN3 alone . Conversely, knockdown of ZDHHC12 results in approximately 50% decrease in S-palmitoylation of CLDN3, confirming ZDHHC12 as the dominant enzyme responsible for CLDN3 palmitoylation .

How does ZDHHC12-mediated palmitoylation impact protein trafficking and localization?

ZDHHC12-mediated palmitoylation plays a crucial role in determining protein subcellular localization, particularly for membrane proteins. In the case of CLDN3:

  • Proper S-palmitoylation by ZDHHC12 facilitates cytomembrane targeting of CLDN3

  • When ZDHHC12 is knocked down, CLDN3 shows insufficient S-palmitoylation leading to intracellular distribution rather than membrane localization

  • Confocal microscopy reveals that ZDHHC12 knockdown hinders CLDN3 targeting to the cytomembrane, resulting in partial intracellular mislocalization

Quantitative analysis of colocalization between CLDN3 and ZO-1 (a tight junction protein) further demonstrates that ZDHHC12 knockdown significantly reduces their colocalization at cell junctions . This evidence indicates that ZDHHC12-mediated palmitoylation serves as a molecular switch that determines whether proteins like CLDN3 properly localize to their functional sites or remain mislocalized within the cell.

What is the role of ZDHHC12 in cancer progression and how is it dysregulated in malignancies?

ZDHHC12 exhibits oncogenic properties in several cancer types, with particularly strong evidence in ovarian cancer:

  • Analysis of The Cancer Genome Atlas (TCGA) data reveals significantly elevated ZDHHC12 expression in ovarian cancer tissues

  • Among all ZDHHC enzymes, ZDHHC12 demonstrates the strongest positive association with reactive oxygen species (ROS) pathways in ovarian cancer

  • Transcriptomic analysis of ovarian cancer datasets shows a robust link between ZDHHC12 expression and signature pathways involving mitochondrial oxidative metabolism and ROS regulation

The oncogenic function of ZDHHC12 appears to operate through multiple mechanisms:

  • Promotion of cancer cell proliferation and tumor growth

  • Regulation of mitochondrial function and ROS homeostasis

  • Stabilization of oncoproteins like CLDN3 through palmitoylation

  • Activation of pro-tumorigenic signaling pathways, including MAPK/ERK

In vivo studies demonstrated that silencing ZDHHC12 significantly inhibits tumorigenesis and tumor growth in ovarian cancer xenograft models . When OVCAR8 cells with shRNA targeting ZDHHC12 were implanted in BALB/c-nu mice, the tumorigenesis and growth rate were substantially slower than in control groups .

How does ZDHHC12 contribute to mitochondrial function and reactive oxygen species (ROS) regulation?

ZDHHC12 plays a critical role in maintaining mitochondrial homeostasis and ROS balance in cancer cells:

  • ZDHHC12 expression strongly correlates with mitochondrial oxidative metabolism pathways in ovarian cancer

  • Knockdown of ZDHHC12 leads to:

    • Increased cellular complexity

    • Elevated ATP levels

    • Enhanced mitochondrial activity

    • Increased both mitochondrial and cellular ROS levels

This dysregulation of mitochondrial function and ROS homeostasis represents a key mechanism by which ZDHHC12 influences cancer cell biology. While the precise molecular targets mediating these effects require further characterization, the data suggest ZDHHC12 acts as a master regulator of cancer cell metabolism and redox balance .

How can targeting ZDHHC12 enhance chemotherapy efficacy in cancer treatment?

Inhibition of ZDHHC12 shows significant promise as a strategy to improve chemotherapy response, particularly for platinum-based treatments in ovarian cancer:

Intervention MethodMechanismExperimental ModelsOutcome
siRNA knockdownGenetic silencing2D and 3D spheroid modelsEnhanced cisplatin cytotoxicity
2BP treatmentChemical inhibition of palmitoylationCell lines and xenograftsIncreased cisplatin sensitivity
C75 treatmentInhibition of fatty acid synthaseIn vitro and in vivo modelsAugmented cisplatin efficacy

The mechanism involves disruption of ROS homeostasis in cancer cells, leading to increased cellular and mitochondrial ROS levels that potentiate cisplatin-induced cytotoxicity . Importantly, ZDHHC12 inhibition significantly enhanced the anti-tumor activity of cisplatin in an ovarian cancer xenograft tumor model and in an ascites-derived organoid line of platinum-resistant ovarian cancer .

These findings have significant clinical implications, suggesting that targeting ZDHHC12 could represent a novel approach to overcome chemotherapy resistance in aggressive cancers like high-grade serous ovarian cancer (HGSOC).

What is the relationship between ZDHHC12 and CLDN3 in ovarian cancer tumorigenesis?

ZDHHC12 and CLDN3 exhibit a functionally significant relationship in ovarian cancer:

  • ZDHHC12 mediates S-palmitoylation of CLDN3 on multiple cysteines (Cys181, Cys182, and Cys184) in its C-terminus region

  • This palmitoylation is essential for CLDN3's oncogenic function:

    • Promotes proper membrane localization of CLDN3

    • Maintains CLDN3 protein stability

    • Activates downstream signaling pathways including MAPK/ERK

  • Clinical evidence shows a positive correlation between ZDHHC12 and CLDN3 expression in ovarian cancer samples at both protein and mRNA levels

When ZDHHC12 is knocked down, CLDN3 shows insufficient S-palmitoylation, leading to:

  • Intracellular mislocalization rather than membrane targeting

  • Increased susceptibility to degradation

  • Diminished activation of oncogenic signaling pathways

  • Reduced tumor growth in experimental models

This relationship represents a mechanistic explanation for how ZDHHC12 promotes ovarian cancer progression and identifies the ZDHHC12-CLDN3 axis as a potential therapeutic target.

What are the key considerations for generating and working with recombinant ZDHHC12 protein?

When working with recombinant ZDHHC12, researchers should consider:

  • Expression system selection: Mammalian expression systems are often preferred for ensuring proper folding and post-translational modifications of human ZDHHC12

  • Purification strategy: Affinity purification methods yield high-purity preparations suitable for enzymatic and structural studies

  • Storage conditions: 50% Glycerol, 0.01M PBS at pH 7.4 with 0.03% Proclin 300 preservative maintains protein stability

  • Activity assessment: Functional assays measuring palmitoyltransferase activity are essential to confirm the enzymatic competence of recombinant preparations

Different species variants of ZDHHC12 (human, cynomolgus/rhesus macaque, rat, mouse, feline, canine, bovine, and equine) are available for comparative studies , allowing researchers to investigate species-specific differences in ZDHHC12 function and regulation.

What challenges exist in developing specific inhibitors of ZDHHC12 for research and therapeutic applications?

Development of specific ZDHHC12 inhibitors faces several challenges:

  • Selectivity across ZDHHC family: The ZDHHC family comprises 23 members with similar catalytic domains, making selective targeting difficult

  • Structural information: Limited high-resolution structural data for ZDHHC12 hampers structure-based drug design

  • Assay development: Establishing high-throughput screening assays specific for ZDHHC12 activity

  • In vivo validation: Confirming target engagement and specificity in complex biological systems

Current approaches rely on general palmitoylation inhibitors like 2-bromopalmitate (2BP) or indirect strategies like fatty acid synthase inhibition with C75 . While these approaches have demonstrated efficacy in experimental models, development of ZDHHC12-specific inhibitors remains an important goal for both research and potential therapeutic applications.

What are the future directions for ZDHHC12 research and its potential clinical applications?

Future research on ZDHHC12 should address several key areas:

  • Comprehensive substrate identification: Beyond CLDN3, identifying the complete set of ZDHHC12 substrates will provide deeper insights into its biological functions

  • Structural characterization: High-resolution structural studies of ZDHHC12 will facilitate rational drug design

  • Tissue-specific functions: Understanding ZDHHC12's role across different tissues and cell types, particularly in the nervous system where expression patterns vary significantly

  • Development of specific inhibitors: Creating selective ZDHHC12 inhibitors for research and potential therapeutic applications

  • Combination therapy optimization: Determining optimal combinations of ZDHHC12 inhibition with standard chemotherapies for maximal clinical benefit

  • Biomarker development: Identifying biomarkers that predict response to ZDHHC12-targeting strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.