Recombinant Human Probable palmitoyltransferase ZDHHC14 (ZDHHC14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Probable Palmitoyltransferase ZDHHC14 (ZDHHC14)

ZDHHC14 is a member of the zinc finger DHHC-type palmitoyltransferase (PAT) family, enzymes responsible for post-translational palmitoylation of proteins. Palmitoylation involves the attachment of palmitic acid to cysteine residues, a modification critical for protein localization, stability, and interactions . The recombinant form of ZDHHC14 is engineered for experimental or therapeutic applications, often expressed in E. coli or other systems with affinity tags (e.g., His-tag) for purification .

Table 1: Recombinant ZDHHC14 Production and Features

FeatureDetailsSource
Expression SystemE. coli (His-tagged) or cell-free systems (Strep-tagged)
SequenceFull-length (1-489 aa in mouse, 1-488 aa in human)
Purity>90% (SDS-PAGE confirmed)
ApplicationsBiochemical assays, protein-protein interaction studies, cancer research

Neuronal Excitability and Ion Channel Regulation

ZDHHC14 palmitoylates PSD93, a scaffold protein, and Kv1-family potassium channels, directing their clustering at the axon initial segment (AIS) . This localization is critical for regulating action potential firing:

  • ZDHHC14 Knockdown: Reduces palmitoylation of PSD93 (by >60%) and Kv1 channels (Kv1.1: 35%, Kv1.4: 65%), leading to:

    • Impaired AIS targeting of Kv1 channels.

    • Increased neuronal excitability (enhanced action potential firing) .

Role in Cancer Progression

Overexpression of ZDHHC14 is linked to aggressive gastric cancer (GC) phenotypes:

  • Clinical Correlation:

    • T/N Ratio >2: Observed in 26.8% of GC cases (vs. non-neoplastic mucosa) .

    • Associations: Depth of tumor invasion, undifferentiated histology, scirrhous subtype .

  • Functional Impact:

    • Knockdown: Reduces GC cell invasion, migration, and adhesion (e.g., 44As3 cells show 50% fewer adherent cells post-siRNA) .

    • Mechanism: Regulates integrin α5/β1 expression and cell motility .

Mechanistic Insights

  • PDZ-Ligand Dependency: ZDHHC14’s LSSV motif binds PSD93’s PDZ domain, enabling substrate recognition and palmitoylation .

  • Developmental Co-regulation: ZDHHC14, PSD93, and Kv1 channels are co-expressed during hippocampal maturation (DIV8–16) .

Therapeutic Targets

  • Epilepsy: ZDHHC14 inhibitors may reduce neuronal hyperexcitability by modulating Kv1 channel activity .

  • Cancer: Targeting ZDHHC14 could suppress metastasis in GC by disrupting integrin-mediated adhesion .

Experimental Tools

  • Recombinant Protein: Used in in vitro palmitoylation assays (e.g., ABE assay for PSD93/Kv1 palmitoylation) .

  • Antibodies: Polyclonal antibodies (e.g., PA5-98601) enable detection of ZDHHC14 in Western blots .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
ZDHHC14; Palmitoyltransferase ZDHHC14; DHHC domain-containing cysteine-rich protein 14; DHHC-14; NEW1 domain-containing protein; NEW1CP; Zinc finger DHHC domain-containing protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC14
Target Protein Sequence
MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQ TGVFYLTLVLILVTSGLFFAFDCPYLAVKITPAIPAVAGILFFFVMGTLLRTSFSDPGVL PRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASH CSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVILRSQQTG FLNALKDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYN PYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQD QCIQSTKFVLQAAATPLLQSEPSLTSDELHLPGKPGLGTPCASLTLGPPTPPASMPNLAE ATLADVMPRKDEHMGHQFLTPDEAPSPPRLLAAGSPLAHSRTMHVLGLASQDSLHEDSVR GLVKLSSV
Uniprot No.

Target Background

Function
ZDHHC14 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It may exhibit palmitoyltransferase activity towards the β-2 adrenergic receptor (ADRB2), thereby modulating G protein-coupled receptor signaling. It may also play a role in cell differentiation and apoptosis.
Gene References Into Functions
  1. Studies suggest ZDHHC14 involvement in scirrhous-type gastric cancer progression. PMID: 24807047
  2. ZDHHC14 has been identified as a potential tumor suppressor gene frequently downregulated in testicular germ cell tumors and prostate cancer. PMID: 24407904
Database Links

HGNC: 20341

KEGG: hsa:79683

STRING: 9606.ENSP00000352821

UniGene: Hs.596214

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the primary function of ZDHHC14 in neuronal cells?

ZDHHC14 functions as a palmitoyl acyltransferase that controls the palmitoylation and axon initial segment (AIS) clustering of PSD93 (a PDZ domain-containing scaffold protein) and Kv1-family potassium channels. It plays a crucial role in regulating neuronal excitability by facilitating proper localization of these channels at the AIS. Loss of ZDHHC14 significantly increases neuronal excitability, which could be explained by reduced Kv1 channel presence at the AIS .

How does ZDHHC14 differ structurally from other palmitoyl acyltransferases?

ZDHHC14 possesses a unique C-terminal Type-I PDZ ligand (LSSV [Leu-Ser-Ser-Val-COOH]) that distinguishes it from other PATs. While several PATs (seven of 24 mouse and eight of 23 human PATs) have sequences that terminate in predicted PDZ ligands, only ZDHHC14 terminates in a Type-I PDZ ligand. This unique structural feature enables ZDHHC14 to directly interact with PDZ domain-containing proteins, particularly PSD93, through a PDZ ligand-dependent manner .

What is the subcellular localization pattern of ZDHHC14?

Despite controlling AIS targeting of channels, ZDHHC14 itself is not enriched at the axon initial segment. Instead, it predominantly localizes to the Golgi apparatus. This localization pattern suggests that ZDHHC14 facilitates palmitoylation of target proteins at the Golgi, which then enables their subsequent trafficking to specific subcellular compartments such as the AIS. This mechanism appears similar to other cases where palmitoylation within the Golgi facilitates forward trafficking of ion channels .

When is ZDHHC14 expressed during neuronal development?

ZDHHC14 shows a specific developmental expression profile in hippocampal neurons that closely mirrors that of its substrates and interactors. It becomes detectable around day in vitro (DIV) 8 and steadily increases until DIV16. This expression pattern is almost identical to that of PSD93, Kv1.1, Kv1.2, and Kv1.4, suggesting coordinated developmental upregulation consistent with a shared function in hippocampal neurons. In contrast, other neuronal proteins like the GLUN2B subunit of NMDA receptors follow different developmental trajectories .

What is the proposed mechanism by which ZDHHC14 controls Kv1 channel trafficking to the AIS?

Current evidence supports a model where PSD93 acts as a scaffold that brings together Kv1 channels and ZDHHC14 at the Golgi apparatus. This scaffolding arrangement facilitates ZDHHC14-dependent palmitoylation of Kv1 channels and their subsequent co-trafficking with PSD93 to the AIS. This mechanism is supported by several findings: (1) ZDHHC14 binds PDZ domain 3 of PSD93, while Kv1.4 binds PDZ domain 2, allowing simultaneous interaction; (2) the C-termini of Kv1.1, Kv1.2, and Kv1.4 all terminate in Type-I PDZ ligands critical for their axonal targeting; (3) ZDHHC14 is predominantly localized to the Golgi rather than the AIS; and (4) knockdown of ZDHHC14 reduces both palmitoylation and AIS targeting of Kv1 channels .

To what extent is residual palmitoylation of PSD93 and Kv1 channels present after ZDHHC14 knockdown?

Knockdown of ZDHHC14 significantly reduces but does not completely eliminate palmitoylation of PSD93 and Kv1 channels. Specifically, ZDHHC14 knockdown reduces PSD93 palmitoylation by >60% and Kv1.1, Kv1.2, and Kv1.4 palmitoylation by 35%, 31%, and 65%, respectively. This residual palmitoylation may be attributable to incomplete knockdown and/or the presence of other PATs with overlapping substrate specificity. For example, recent research suggests that zebrafish Kv1.1 can be palmitoylated by another PAT, ZDHHC17/HIP14, though ZDHHC17 is less likely to mediate residual PSD93 palmitoylation as it lacks a Type-I PDZ ligand and its loss does not affect PSD93 palmitoylation in mice .

How does the effect of ZDHHC14 on neuronal excitability compare to its effect on Kv1 channel localization?

Interestingly, ZDHHC14 loss produces a more dramatic effect on neuronal excitability than would be predicted based solely on its impact on AIS targeting of individual Kv1 channels. This discrepancy suggests that ZDHHC14 may have additional roles beyond regulating channel trafficking. Two primary hypotheses emerge: (1) palmitoylation may directly modulate Kv1 channel electrophysiological properties, as previously demonstrated for Kv1.1 where palmitoylation affects voltage-sensing and current amplitude; and (2) ZDHHC14 may function as a master regulator of multiple AIS ion channels and/or scaffold proteins, with broader impacts on neuronal excitability beyond just Kv1 channels .

What techniques can be used to study ZDHHC14-mediated protein palmitoylation?

The acyl-biotin exchange (ABE) assay is the primary non-radioactive technique used to purify and quantify palmitoylated proteins from cell lysates when studying ZDHHC14-mediated palmitoylation. The procedure involves:

  • Preparation of cell lysates from control and experimental conditions (e.g., with/without ZDHHC14 overexpression or knockdown)

  • Blocking of free thiols with N-ethylmaleimide

  • Treatment with hydroxylamine to cleave thioester bonds, exposing palmitoylation sites

  • Biotinylation of the newly exposed thiols

  • Purification using streptavidin beads

  • Analysis by western blotting

This method has been successfully employed to demonstrate ZDHHC14-dependent palmitoylation of PSD93 and Kv1 channels in both heterologous expression systems and primary neuronal cultures. Specificity can be confirmed by including non-palmitoylated proteins (e.g., ERK) as negative controls, which should not be detected in ABE samples .

How can researchers effectively knock down ZDHHC14 expression in neuronal cultures?

Lentiviral-mediated shRNA delivery has proven effective for ZDHHC14 knockdown in primary hippocampal neurons. The protocol typically involves:

  • Designing specific shRNAs targeting Zdhhc14 mRNA (multiple independent shRNAs should be tested)

  • Packaging shRNAs into lentiviral vectors

  • Transducing primary hippocampal neurons at day in vitro (DIV) 9

  • Allowing 7 days for effective knockdown (harvesting at DIV16)

  • Confirming knockdown efficiency by western blotting (>90% reduction is achievable)

Using two independent shRNAs (Zdhhc14 sh#1 and sh#2) allows validation that observed phenotypes are specifically due to ZDHHC14 reduction rather than off-target effects. Control conditions should include neurons transduced with non-targeting shRNA lentivirus .

What imaging approaches can assess the impact of ZDHHC14 on protein subcellular localization?

Immunofluorescence microscopy with quantitative analysis is essential for assessing ZDHHC14's impact on subcellular targeting of proteins such as Kv1 channels to the AIS:

  • Prepare primary neuronal cultures with ZDHHC14 knockdown or control conditions

  • Fix cells and perform immunostaining for:

    • Target proteins (e.g., Kv1.1, Kv1.2, Kv1.4)

    • AIS markers (e.g., AnkyrinG)

    • Additional neuronal markers as needed

  • Acquire high-resolution confocal images

  • Quantify AIS localization parameters:

    • Mean fluorescence intensity at the AIS

    • Ratio of AIS to non-AIS signal

    • Total amount of AIS-localized protein

Statistical analysis should compare multiple parameters between control and ZDHHC14-knockdown conditions, as different aspects of localization (intensity vs. total amount) may be differentially affected .

How should researchers interpret changes in total protein levels versus palmitoylation levels after ZDHHC14 manipulation?

When manipulating ZDHHC14 expression, researchers often observe changes in both palmitoylation and total protein levels of substrates, requiring careful data interpretation:

ProteinPalmitoylation ReductionTotal Level ReductionInterpretation
PSD93>60%Lesser extentPrimary effect on palmitoylation, secondary effect on stability
Kv1.231%Lesser extentPrimary effect on palmitoylation, secondary effect on stability
Kv1.465%Lesser extentPrimary effect on palmitoylation, secondary effect on stability
GAP43No changeNo changeNot a ZDHHC14 substrate

When palmitoylation reduction exceeds total protein reduction, this suggests ZDHHC14 primarily affects palmitoylation, with protein level changes as a secondary consequence, potentially due to decreased stability of non-palmitoylated forms. Proper analysis requires normalizing palmitoylation signals to total protein levels to distinguish these effects .

What controls are necessary when assessing ZDHHC14-mediated palmitoylation specificity?

To establish ZDHHC14 palmitoylation specificity, several crucial controls are necessary:

  • Substrate Specificity Controls:

    • Include known non-substrates (e.g., GAP43 is unaffected by ZDHHC14 knockdown)

    • Test multiple potential substrates (PSD93α vs. PSD93β show different magnitudes of effect)

  • ABE Assay Controls:

    • Include non-palmitoylated proteins (e.g., ERK) to confirm assay specificity

    • Include hydroxylamine-omitted controls to verify thioester bond specificity

  • Knockdown Controls:

    • Use multiple independent shRNAs to confirm specificity of observed effects

    • Include non-targeting shRNA controls

    • Rescue experiments with shRNA-resistant ZDHHC14 constructs

These controls collectively ensure that observed changes in protein palmitoylation are specifically attributable to ZDHHC14 activity rather than technical artifacts or off-target effects .

What are the potential implications of ZDHHC14 dysfunction in neurological disorders?

ZDHHC14 dysfunction may contribute to neurological disorders characterized by neuronal hyperexcitability, given its role in regulating Kv1 channels and PSD93. The evidence supporting this includes:

  • ZDHHC14 is one of only four PATs intolerant to loss-of-function genetic mutations in humans

  • ZDHHC14 knockdown significantly increases neuronal excitability

  • Mutations in Kv1 channel genes and copy number variations of the Dlg2 gene (encoding PSD93) are associated with multiple neurological conditions:

    • Epilepsy

    • Myokemia

    • Episodic ataxia

    • Schizophrenia

    • Autism spectrum disorder

    • Intellectual disability

These connections suggest ZDHHC14 could be a promising therapeutic target for disorders involving dysregulated neuronal excitability. Future research should investigate associations between ZDHHC14 variants and these neurological conditions, as well as potential interventions to modulate ZDHHC14 activity .

What additional ZDHHC14 substrates might exist beyond PSD93 and Kv1 channels?

The dramatic effect of ZDHHC14 loss on neuronal excitability compared to its effect on individual Kv1 channel localization suggests ZDHHC14 may have additional, undiscovered substrates. Potential candidates include:

  • Other ion channels localized to the AIS

  • Additional scaffold proteins that regulate channel clustering

  • Proteins involved in AIS structure and maintenance

  • Modulatory proteins that affect channel function

A comprehensive proteomics approach comparing palmitoylated proteins in control versus ZDHHC14-knockdown neurons could identify additional substrates. Candidate proteins should be validated through targeted approaches including ABE assays, co-immunoprecipitation, and functional studies .

How might the unique PDZ-binding properties of ZDHHC14 be leveraged for therapeutic interventions?

The unique PDZ-binding properties of ZDHHC14 offer potential for developing specific therapeutic interventions:

  • Small molecules or peptides that target the ZDHHC14-PSD93 interaction could modulate neuronal excitability

  • Structure-based drug design focusing on the LSSV PDZ-binding motif might yield compounds that selectively enhance or inhibit ZDHHC14 activity

  • Gene therapy approaches targeting ZDHHC14 expression could be explored for treating conditions marked by hyperexcitability

Research should focus on determining the crystal structure of ZDHHC14 in complex with its PDZ domain partners to facilitate rational drug design. Additionally, high-throughput screening for compounds that modulate ZDHHC14-PDZ interactions could yield candidate therapeutics for neurological disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.