Recombinant Human Probable palmitoyltransferase ZDHHC19 (ZDHHC19)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC19; Palmitoyltransferase ZDHHC19; Zinc finger DHHC domain-containing protein 19; DHHC-19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC19
Target Protein Sequence
MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ SREGTPGAW
Uniprot No.

Target Background

Function
ZDHHC19, a palmitoyltransferase, mediates palmitoylation of RRAS, leading to increased cell viability. It also promotes Chikungunya virus (CHIKV) replication by mediating viral nsp1 palmitoylation.
Gene References Into Functions
  1. Co-transfection of DHHC19 with R-Ras results in increased palmitoylation of R-Ras, accompanied by enhanced membrane association and localization within rafts/caveolae. PMID: 20074548
Database Links

HGNC: 20713

KEGG: hsa:131540

STRING: 9606.ENSP00000296326

UniGene: Hs.111591

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is the subcellular localization pattern of ZDHHC19?

ZDHHC19 demonstrates a distinct perinuclear distribution pattern similar to other palmitoyl transferases. Transfection experiments with full-length ZDHHC19 in COS7 cells revealed strong colocalization with trans-Golgi markers Gal-T and TGN38 . The amino acid sequence at the carboxy-terminus of ZDHHC19 contains a conserved CaaX box that directs the protein away from the nucleus toward perinuclear regions .

Recent research has also demonstrated that ZDHHC19 can localize to the plasma membrane, particularly in male germ cells, where its localization is dependent on interaction with TEX38 . The dynamic localization of ZDHHC19 appears to be tissue and context-dependent, reflecting its diverse functional roles in different cellular environments.

What are the known substrates of ZDHHC19's palmitoyltransferase activity?

ZDHHC19 demonstrates selective substrate specificity among small GTPases. Experimental evidence indicates that ZDHHC19 significantly increases the palmitoylation of R-Ras (approximately two-fold), while failing to enhance palmitoylation of other small GTPases including H-Ras, N-Ras, K-Ras4A, RhoB, and Rap2 . This selectivity suggests a specialized role for ZDHHC19 in R-Ras signaling pathways.

Recent research has identified additional substrates, including:

  • STAT3 - ZDHHC19 mediates S-palmitoylation at the SRC homology 2 (SH2) domain of STAT3, promoting its dimerization and transcriptional activation (Note: this finding has been subject to scholarly debate and further verification may be needed).

  • ARRDC5 - In male germ cells, ZDHHC19 palmitoylates ARRDC5, an arrestin family protein that regulates sperm differentiation .

How does ZDHHC19-mediated palmitoylation affect protein function?

The functional consequences of ZDHHC19-mediated palmitoylation vary depending on the substrate:

  • R-Ras palmitoylation: When ZDHHC19 increases R-Ras palmitoylation, it leads to:

    • Augmented association of R-Ras with cellular membranes

    • Enhanced localization of R-Ras to rafts/caveolae

    • Increased viability of transfected cells, particularly when using activated GTP-bound forms of R-Ras (G38V)

  • ARRDC5 palmitoylation: In spermatids, ZDHHC19-mediated palmitoylation of ARRDC5 is essential for:

    • Proper sperm head morphogenesis

    • Prevention of excess residual cytoplasm retention around the sperm head

    • Normal sperm function and male fertility

The palmitoylation-induced effects generally involve altered protein localization, stability, and protein-protein interactions, which collectively modify downstream signaling pathways.

What is the interplay between TEX38 and ZDHHC19 in male germ cells?

The relationship between TEX38 and ZDHHC19 represents a fascinating example of protein interdependence. Research shows that:

  • TEX38 and ZDHHC19 physically interact and colocalize at the plasma membrane of spermatids

  • Their relationship is reciprocal - each protein impacts the other's expression levels:

    • ZDHHC19 is downregulated in mouse testes lacking TEX38

    • TEX38 is downregulated in mouse testes lacking ZDHHC19

  • TEX38 stabilizes ZDHHC19 and localizes it to the plasma membrane in cultured cells and vice versa, establishing a mutually dependent protein complex

  • Functional significance:

    • Knockout of either TEX38 or ZDHHC19 results in remarkably similar phenotypes:

      • Sperm head malformation

      • Abnormal retention of residual cytoplasm

      • Male infertility

This interdependence highlights a specialized mechanism for regulating ZDHHC19 activity in the male germline, ensuring proper localization and function during critical stages of spermatogenesis.

How does ZDHHC19 activity interface with cellular lipid metabolism?

ZDHHC19's function as a palmitoyl transferase inherently connects it to cellular lipid metabolism. Evidence suggests that:

  • Fatty acids can enhance ZDHHC19-mediated palmitoylation of target proteins, establishing a direct link between cellular lipid availability and post-translational modifications

  • In experimental models, fatty acids synergize with cytokine stimulation to promote ZDHHC19-dependent palmitoylation reactions

  • The mechanisms connecting fatty acid metabolism to ZDHHC19 activity may involve:

    • Increased availability of palmitoyl-CoA as substrate

    • Altered membrane lipid composition affecting enzyme-substrate interactions

    • Potential allosteric regulation of ZDHHC19 by lipid metabolites

  • Physiological implications:

    • Changes in dietary fatty acids or metabolic disorders could potentially affect ZDHHC19-dependent cellular processes

    • ZDHHC19 may serve as a sensor linking nutritional status to post-translational regulation of signaling pathways

What is the role of ZDHHC19 in pathological conditions?

Several lines of evidence implicate ZDHHC19 in pathological processes:

  • Cancer association:

    • Genomic amplification of ZDHHC19 occurs in multiple human cancers

    • Particularly prevalent in lung squamous cell carcinoma (approximately 39% of cases)

    • High ZDHHC19 expression correlates with elevated nuclear STAT3 levels in patient samples

  • Experimental evidence:

    • ZDHHC19 knockout in lung squamous cell carcinoma cells:

      • Blocks STAT3 activity

      • Inhibits fatty-acid-induced tumor sphere formation

      • Reduces tumorigenesis in high-fat diet mouse models

  • Male infertility:

    • Disruption of ZDHHC19 palmitoylation activity (C142S mutation) results in:

      • Abnormal sperm morphology with backward head bending

      • Excess retention of residual cytoplasm around the sperm head

      • Complete male infertility

Pathological ConditionZDHHC19 RoleEvidence
Lung Squamous Cell CarcinomaGenomic amplification in ~39% of casesPatient sample analysis
Cancer Cell GrowthPromotes tumorigenesisZDHHC19 knockout reduces tumor sphere formation
Male InfertilityEssential for sperm morphogenesisKnockout or C142S mutation causes infertility

What are the established methods for detecting ZDHHC19-mediated protein palmitoylation?

Several complementary techniques are used to detect and quantify ZDHHC19-mediated palmitoylation:

  • Metabolic labeling with radioactive palmitate:

    • Cells expressing ZDHHC19 and substrate proteins are incubated with [³H]-palmitic acid

    • Proteins are immunoprecipitated and analyzed by SDS-PAGE followed by fluorography

    • This approach allows quantification of palmitoylation by measuring incorporated radioactivity

  • Acyl-biotin exchange (ABE) assay:

    • Free thiols are blocked with N-ethylmaleimide

    • Thioester bonds of palmitoylated cysteines are cleaved with hydroxylamine

    • Newly exposed thiols are labeled with biotin-HPDP

    • Biotinylated proteins are captured on streptavidin beads and analyzed

  • Click chemistry-based detection:

    • Cells are labeled with alkyne-modified palmitic acid analogs

    • Copper-catalyzed azide-alkyne cycloaddition is used to attach detection tags

    • Palmitoylated proteins are visualized by fluorescence or analyzed by mass spectrometry

  • Mass spectrometry analysis:

    • Allows identification of specific palmitoylation sites

    • Can be combined with stable isotope labeling for quantitative analysis

    • Particularly valuable for discovering novel ZDHHC19 substrates

These methods can be combined with ZDHHC19 overexpression, knockdown, or mutation studies to establish the specificity of the observed palmitoylation events.

How can researchers generate and validate functional ZDHHC19 mutants?

Creating and validating ZDHHC19 mutants is essential for dissecting its functional domains:

  • Key mutation strategies:

    • DHHC catalytic domain mutations:

      • C142S mutation disrupts the catalytic cysteine in the DHHC motif, abolishing palmitoyltransferase activity

      • This mutation serves as a negative control for ZDHHC19 enzymatic function

    • CaaX box mutations:

      • Alterations in the carboxy-terminal CaaX motif to assess its role in localization

      • Can be used to generate ZDHHC19 variants with altered subcellular distribution

    • Protein interaction domain mutations:

      • Based on identified interactions with TEX38, GRB2, or other partners

      • Point mutations or deletion constructs to disrupt specific protein-protein interactions

  • Validation approaches:

    • Enzymatic activity assays using established substrates (R-Ras, ARRDC5)

    • Localization studies using immunofluorescence or fractionation methods

    • Protein stability assessments through cycloheximide chase experiments

    • Functional rescue experiments in ZDHHC19-knockout models

  • In vivo validation:

    • CRISPR/Cas9-mediated knockin of specific mutations in mouse models

    • Assessment of phenotypic consequences, particularly in male fertility models

    • Comparison of mutant phenotypes with complete knockout phenotypes to distinguish catalytic versus structural roles

What model systems are most appropriate for studying ZDHHC19 function?

Various experimental models have been successfully employed to study ZDHHC19:

  • Cell culture models:

    • COS7 cells: Commonly used for localization and basic palmitoylation studies

    • Lung squamous cell carcinoma cell lines: For cancer-related functions

    • Male germ cell lines: For reproductive biology investigations

    • Primary cell cultures from relevant tissues

  • Animal models:

    • Mouse knockout models:

      • Zdhhc19-knockout mice exhibit male infertility

      • C142S knockin mice show similar phenotypes to complete knockouts

    • Conditional knockout models may be valuable for tissue-specific studies

    • High-fat diet mouse models for tumor formation studies

  • Patient-derived samples:

    • Analysis of ZDHHC19 expression in cancer patient samples

    • Correlation studies with clinical outcomes and cellular signaling markers

    • Potential for investigating ZDHHC19 mutations in male infertility cases

Selection criteria for appropriate models should consider:

  • Expression levels of ZDHHC19 in the model system

  • Presence of relevant substrate proteins

  • Physiological relevance to the specific function being investigated

  • Technical feasibility of genetic manipulation

How should researchers address discrepancies in ZDHHC19 substrate specificity across different studies?

Resolving inconsistencies in ZDHHC19 substrate specificity requires systematic approaches:

  • Key considerations for reconciling conflicting data:

    • Experimental conditions significantly impact palmitoylation assays

    • Cell type-specific factors may modulate ZDHHC19 activity

    • Expression levels of ZDHHC19 could affect substrate selection

    • Presence of scaffolding proteins (like TEX38) may alter substrate specificity

  • Recommended analytical approach:

    • Direct side-by-side comparison of different substrates under identical conditions

    • Titration experiments with varying enzyme:substrate ratios

    • Assessment of substrate competition in mixed reaction systems

    • Investigation of cell type-specific cofactors that may influence specificity

  • Control experiments to validate specificity:

    • Parallel analysis with other DHHC family members

    • Use of catalytically inactive ZDHHC19 (C142S) as negative control

    • Rescue experiments in ZDHHC19-knockout backgrounds

    • In vitro reconstitution with purified components

  • Data integration strategy:

    • Develop a hierarchical model of ZDHHC19 substrate preference

    • Consider context-dependent regulation of substrate selection

    • Evaluate potential conditional specificity based on cellular state

What are the implications of ZDHHC19's role in male fertility for broader research applications?

The discovery of ZDHHC19's essential role in male fertility opens several research avenues:

  • Diagnostic applications:

    • ZDHHC19 mutations or expression changes could be biomarkers for idiopathic male infertility

    • Functional assessment of ZDHHC19 activity might predict sperm quality

    • Analysis of the TEX38-ZDHHC19-ARRDC5 pathway could reveal novel infertility mechanisms

  • Therapeutic potential:

    • The specific expression and function of ZDHHC19 in male germ cells makes it a candidate target for non-hormonal male contraceptives

    • Selective inhibitors of ZDHHC19 could potentially be developed for contraceptive applications

    • Conversely, enhancing ZDHHC19 function might address certain forms of male infertility

  • Basic research implications:

    • The ZDHHC19-TEX38 system provides a model for studying membrane protein complex formation

    • Insights into tissue-specific regulation of palmitoylation enzymes

    • Model for investigating lipid modifications in specialized cellular differentiation processes

  • Evolutionary perspective:

    • Comparative analysis of ZDHHC19 function across species may reveal evolutionary adaptations in sperm morphogenesis

    • Conservation analysis of the TEX38-ZDHHC19-ARRDC5 pathway across diverse organisms

How can researchers distinguish between direct and indirect effects of ZDHHC19 manipulation in experimental systems?

Differentiating direct ZDHHC19 effects from secondary consequences requires rigorous experimental design:

  • Temporal analysis approaches:

    • Acute versus chronic manipulation of ZDHHC19 (inducible systems)

    • Time-course studies to establish the sequence of cellular events

    • Pulse-chase experiments to track the dynamics of palmitoylation events

  • Substrate-specific validation strategies:

    • Site-directed mutagenesis of predicted palmitoylation sites on putative substrates

    • Creation of palmitoylation-mimetic mutations (cysteine to hydrophobic residues)

    • Direct assessment of purified components in reconstituted systems

  • Rescue experiment designs:

    • Wild-type ZDHHC19 versus catalytically inactive mutant rescue

    • Structure-function analysis with domain-specific mutants

    • Bypass experiments using chemical palmitoylation approaches

  • Multi-level data integration:

    • Correlation of palmitoylation changes with functional outcomes

    • Systems biology approaches to map the palmitoylation network

    • Mathematical modeling of direct versus feed-forward effects

Experimental ApproachAdvantagesLimitations
Inducible ZDHHC19 expression/deletionTemporal control, reduces adaptationSystem leakiness, expression level artifacts
In vitro reconstitutionDirect assessment of enzyme-substrate relationshipLacks cellular context, potential non-physiological conditions
Palmitoylation site mutationsSpecific targeting of modification sitesMay affect protein structure independently of palmitoylation
Chemical rescue approachesBypasses enzymatic requirementLimited specificity, potential off-target effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.