Recombinant Human Probable palmitoyltransferase ZDHHC1 (ZDHHC1)

Shipped with Ice Packs
In Stock

Description

Key Substrates and Functional Roles

ZDHHC1 modulates diverse cellular processes through substrate-specific palmitoylation:

SubstrateBiological RoleMechanismReference
p53Tumor suppressionEnhances nuclear translocation, stabilizes p53, activates apoptosis
IGF2BP1mRNA stability (e.g., LIPG in CRC)Palmitoylation at Cys337 reduces LIPG expression via m6A modification
SIRT2Autophagy regulationPromotes FOXO1 acetylation, inducing autophagosome formation
β-cateninRenal fibrosisPromotes ubiquitination and degradation, suppressing fibrotic signaling

A. Cancer

  • Colorectal Cancer (CRC):

    • ZDHHC1 is downregulated in CRC tissues, correlating with poor prognosis. It inhibits tumor growth by palmitoylating IGF2BP1, which destabilizes pro-tumorigenic LIPG mRNA .

    • Loss of ZDHHC1 promotes lipid storage and cancer cell proliferation .

  • Breast Cancer:

    • ZDHHC1 acts as a tumor suppressor by enhancing p53 activity. Its promoter hypermethylation silences expression in p53-wildtype cancers .

    • Overexpression induces autophagy via SIRT2 palmitoylation, sensitizing tumors to immunotherapy .

B. Kidney Disease

  • ZDHHC1 expression is reduced in fibrotic kidneys. It palmitoylates β-catenin, promoting its degradation and mitigating renal fibrosis .

  • APT1-mediated depalmitoylation of β-catenin exacerbates fibrosis, making APT1 inhibition a therapeutic target .

Regulatory Mechanisms and Feedback Loops

  • Epigenetic Regulation:

    • p53 recruits DNMT3A to methylate the ZDHHC1 promoter, creating a negative feedback loop that silences ZDHHC1 in cancer .

  • Post-Translational Modifications:

    • Auto-palmitoylation at C-terminal cysteines (e.g., Cys236/237/245 in zDHHC5 homolog) enhances catalytic activity .

Research Tools and Assays

  • NBD-Palmitoyl-CoA Assay:

    • Measures ZDHHC1 activation in native membranes by fluorescent labeling of the active-site cysteine .

    • Kinetic parameters: Km=3.59±0.29μMK_m = 3.59 \pm 0.29 \, \mu M, Vmax=39.55±1.00V_{max} = 39.55 \pm 1.00 (wildtype zDHHC5) .

  • Chemical-Genetic Systems:

    • Enable substrate mapping via engineered zDHHCs and clickable lipid probes .

Therapeutic Potential

  • Targeting Palmitoylation:

    • 2-Bromopalmitate (2BP): Inhibits ZDHHC1, reversing p53 nuclear translocation and autophagy .

    • ML348: APT1 inhibitor that reduces β-catenin stability in kidney fibrosis .

  • Biomarker Development:

    • ZDHHC1 promoter methylation status may predict chemosensitivity in p53-wildtype cancers .

Current Challenges and Future Directions

  • Substrate Specificity: Over 5,000 potential palmitoylation substrates exist, but only a fraction are validated .

  • Context-Dependent Roles: ZDHHC1 exhibits tumor-suppressive or oncogenic effects depending on cellular context (e.g., β-catenin in fibrosis vs. Wnt-driven cancers) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development accordingly.
Synonyms
ZDHHC1; C16orf1; ZNF377; Palmitoyltransferase ZDHHC1; DHHC domain-containing cysteine-rich protein 1; Zinc finger DHHC domain-containing protein 1; DHHC-1; Zinc finger protein 377
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC1
Target Protein Sequence
MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYL FFAVIGFGILVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGPLP IFNRSQHAHVIEDLHCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFL HSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNRHFEVLKNHTDVWFVFLPAAPVETQA PAILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQHRPPQEAKGVHRELES CPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQV EWDRKKPLPWRSPLLLLAMWGPQAPPCLCRKRGRGACIKCERLRPRIRRRGLGPPAAAPA RRRIPRTPALCTPLALPAPTTRRRQSPWTRFQWRRRAWAAPLWPPRGAGADSPRWRGRRV RPPFS
Uniprot No.

Target Background

Function
ZDHHC1 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It exhibits palmitoyltransferase activity towards NCDN and regulates NCDN association with endosome membranes through this palmitoylation process. Additionally, ZDHHC1 possesses a palmitoyltransferase activity-independent function in DNA virus-triggered and CGAS-mediated innate immune response. It acts as an activator of STING1 by promoting its cGAMP-induced oligomerization and the recruitment of downstream signaling components.
Gene References Into Functions
  1. In an expression screen for proteins that can activate the IFNB1 promoter, researchers identified the ER-associated protein ZDHHC1 as a positive regulator of virus-triggered, MITA/STING-dependent immune signaling. PMID: 25299331
Database Links

HGNC: 17916

KEGG: hsa:29800

STRING: 9606.ENSP00000340299

UniGene: Hs.624541

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus.
Tissue Specificity
Widely expressed with significant expression in heart, brain, placenta, lung, liver, kidney, testis, thymus and small intestine. Expressed at lower levels in adult pancreas and lung.

Q&A

What is the basic structure and function of human ZDHHC1 protein?

ZDHHC1 (Zinc Finger DHHC-Type Containing 1) is a member of the ZDHHC family of palmitoyltransferases that catalyzes protein S-palmitoylation, a post-translational modification involving the attachment of long-chain fatty acids (typically palmitate) to cysteine residues of target proteins. The human ZDHHC1 protein contains:

  • A DHHC (Asp-His-His-Cys) domain that serves as the catalytic site

  • Zinc finger motifs critical for proper protein configuration

  • Transmembrane domains characteristic of the ZDHHC family

ZDHHC1's primary function involves mediating S-palmitoylation, which affects protein localization, stability, and function across various cellular processes .

How does ZDHHC1 differ from other members of the ZDHHC family?

While sharing the characteristic DHHC domain with other family members, ZDHHC1 shows distinct:

  • Expression patterns across tissues

  • Substrate specificity

  • Regulatory mechanisms

  • Roles in disease pathophysiology

Unlike some extensively studied ZDHHC proteins (e.g., ZDHHC5, ZDHHC6), ZDHHC1 has been identified as a potential tumor suppressor, particularly in colorectal cancer, which contrasts with the oncogenic roles observed for some other family members .

ZDHHC Family MemberPrimary Cellular LocationKnown FunctionsCancer Relevance
ZDHHC1Intracellular membranesTumor suppression, Lipid metabolism regulationDownregulated in CRC, Suppresses tumor growth
ZDHHC6ER membranesLipid metabolism, Promotes fatty acid synthesisUpregulated in CRC, Promotes tumorigenesis
ZDHHC11Membrane structuresInnate immune response regulationModulates immune response to DNA viruses

What are the recommended methods for detecting ZDHHC1 expression in tissue samples?

For accurate detection of ZDHHC1 expression in tissue samples, a multi-modal approach is recommended:

Protein-level detection:

  • Western blotting using validated antibodies (e.g., PA5-61797) with appropriate recombinant protein controls

  • Immunohistochemistry (IHC) with pre-absorption controls (using 100x molar excess of protein fragment control)

  • Immunofluorescence with proper negative controls

mRNA-level detection:

  • RT-qPCR with validated primers targeting conserved regions

  • RNA-sequencing with appropriate normalization methods

Based on published studies, sensitivity can be enhanced by comparing expression between tumor and adjacent normal tissues using paired samples. When analyzing clinical specimens, correlation with clinical parameters significantly improves data interpretation .

How can researchers effectively measure ZDHHC1 enzymatic activity?

A facile and physiologically relevant approach to measure ZDHHC1 enzymatic activity involves:

  • Auto-S-palmitoylation assay in native membranes:

    • Express HA-tagged ZDHHC1 in HEK293 cells

    • Prepare membrane fractions via probe sonication in isotonic buffer

    • Incubate membranes with NBD-palmitoyl-CoA (a fluorescent palmitate analog)

    • Detect ZDHHC1-bound NBD-palmitate via fluorescence imaging and normalize with Western blotting for HA

This method offers several advantages over purified protein assays:

  • Maintains the enzyme in its native membrane environment

  • Requires less time and resources than protein purification

  • Provides physiologically relevant activity measurements

  • Allows for comparative analysis across different ZDHHC family members or mutants

For mutation studies, active site cysteine mutations (C→S) can serve as negative controls, confirming assay specificity for auto-S-palmitoylation .

What is the role of ZDHHC1 in colorectal cancer (CRC) progression?

ZDHHC1 functions as a tumor suppressor in colorectal cancer through multiple mechanisms:

Lipid metabolism regulation:

  • ZDHHC1 negatively regulates LIPG (lipase G) expression through IGF2BP1 palmitoylation

  • This leads to reduced lipid storage in CRC cells, inhibiting proliferation

Functional consequences of ZDHHC1 expression:

  • Inhibits CRC cell proliferation and invasion in vitro and in vivo

  • Downregulates mRNA stability of oncogenic factors in an m6A-dependent manner

  • Counteracts the metabolic reprogramming characteristic of cancer cells

Clinical data analysis has shown that ZDHHC1 expression is significantly downregulated in CRC tissues compared to adjacent normal tissues, and low ZDHHC1 expression correlates with unfavorable prognosis .

How does ZDHHC1 expression correlate with clinical outcomes in cancer patients?

Comprehensive analyses of clinical databases (TCGA, ICGC) have revealed significant correlations between ZDHHC1 expression and patient outcomes:

In colorectal cancer:

In uterine corpus endometrial carcinoma (UCEC):

The diagnostic value of ZDHHC1 for UCEC has been validated through ROC analysis, with AUC values of 0.753 (TCGA database) and 0.848 (Xena database) .

How does ZDHHC1 regulate lipid metabolism in normal and cancer cells?

ZDHHC1 serves as a critical regulator of lipid metabolism through several mechanisms:

In normal cells:

  • Mediates protein S-palmitoylation of key factors involved in lipid metabolism

  • Modulates cellular lipid composition through regulation of lipase activity

In cancer cells:

  • Functions opposite to ZDHHC6, which promotes fatty acid synthesis in CRC

  • Inhibits lipid storage by downregulating LIPG expression

  • Counteracts metabolic reprogramming that supports cancer cell proliferation

The contrasting roles of ZDHHC family members in lipid metabolism are noteworthy:

  • ZDHHC1: Suppresses tumor growth by inhibiting lipid accumulation

  • ZDHHC6: Promotes tumor growth by enhancing fatty acid synthesis through PPARγ-ACLY signaling

What methodologies can be used to study the impact of ZDHHC1 on cellular lipid profiles?

To comprehensively assess ZDHHC1's impact on cellular lipid profiles, researchers should employ:

Lipidomic analysis:

  • High-throughput metabolomics to identify significantly altered metabolites

  • Liquid chromatography-mass spectrometry (LC-MS) to characterize lipid species

  • Pathway enrichment analysis to identify affected lipid metabolism pathways

Functional assessment:

  • Oil Red O staining to quantify intracellular lipid droplets

  • Triglyceride and free fatty acid measurement assays

  • Metabolic flux analysis using labeled fatty acids or glucose

In CRC research, lipidomic analysis has revealed that ZDHHC1 expression correlates with decreased levels of lipids and lipid-like metabolites, particularly fatty acids (FAs), phosphatidylcholine (PC), phosphatidylethanolamine (PE), and other lipid species. Pathway enrichment analysis identified triacylglycerol production, glycerol phosphate shuttle, and palmitoylated protein pathways as significantly affected by ZDHHC1 .

How does ZDHHC1 influence RNA modifications and gene expression?

ZDHHC1 exerts significant effects on RNA modifications through:

m6A-dependent mechanisms:

  • Palmitoylates IGF2BP1 at C337, affecting its RNA-binding capacity

  • Influences mRNA stability of target genes in an m6A-dependent manner

  • Regulates gene expression through post-transcriptional mechanisms

Association with RNA modification enzymes:

  • Correlates with expression of RNA modification regulators including:

    • m6A writers (METTL3, METTL14, WTAP)

    • m6A readers (YTHDF1, YTHDF2, YTHDF3)

    • m6A erasers (ALKBH5, FTO)

  • These associations suggest ZDHHC1 may coordinate with RNA modification machinery to regulate gene expression

The RM2Target database analysis has identified significant correlations between ZDHHC1 expression and numerous RNA modification genes, providing mechanistic insights into ZDHHC1's role in post-transcriptional regulation .

What experimental approaches are recommended for studying ZDHHC1's impact on gene expression?

To comprehensively analyze ZDHHC1's effect on gene expression, researchers should implement:

Transcriptomic analysis:

  • RNA-sequencing of ZDHHC1-overexpressing or knockdown cells

  • Differential expression analysis to identify ZDHHC1-regulated genes

  • Pathway enrichment to determine biological processes affected

RNA modification assays:

  • Methylated RNA immunoprecipitation sequencing (MeRIP-seq) to map m6A modifications

  • RNA stability assays using actinomycin D and qRT-PCR

  • RNA immunoprecipitation (RIP) to identify ZDHHC1-associated RNAs

Protein-RNA interactions:

  • Crosslinking immunoprecipitation (CLIP) to identify direct RNA targets

  • RNA electrophoretic mobility shift assays (REMSA) to assess binding affinities

  • Luciferase reporter assays to validate functional consequences

Recent studies have demonstrated that ZDHHC1 regulates mRNA stability of LIPG through palmitoylation of IGF2BP1, highlighting the importance of combining protein modification studies with RNA biology approaches .

How can ZDHHC1 be targeted for potential therapeutic applications in cancer?

Several promising approaches for therapeutic targeting of ZDHHC1 include:

Enhancing ZDHHC1 expression or activity:

  • Epigenetic modifiers to reverse promoter methylation (demonstrated to silence ZDHHC1 in multiple cancers)

  • Small molecule activators of ZDHHC1 enzymatic activity

  • Gene therapy approaches to restore ZDHHC1 expression in tumors

Targeting downstream effectors:

  • Inhibitors of pathways activated by ZDHHC1 loss (e.g., lipid metabolism pathways)

  • LIPG inhibitors to mimic ZDHHC1's suppressive effects on lipid storage

  • Modulators of RNA modification machinery that interact with ZDHHC1

Combination therapies:

  • ZDHHC1-based therapies combined with conventional chemotherapeutics

  • Metabolic interventions that synergize with ZDHHC1 restoration

  • Immune modulators that enhance anti-tumor immunity in ZDHHC1-deficient tumors

What are the current challenges and future directions in ZDHHC1 research?

Current challenges:

  • Limited understanding of ZDHHC1's complete substrate repertoire

  • Difficulty in developing specific pharmacological modulators of ZDHHC1

  • Need for improved methodologies to study ZDHHC1 in physiologically relevant contexts

  • Incomplete characterization of ZDHHC1's role across different cancer types

Future research directions:

  • Comprehensive substrate identification using proteomics approaches

  • Development of isoform-specific antibodies and activity assays

  • Investigation of ZDHHC1's role in additional pathophysiological contexts

  • Exploration of potential tissue-specific functions and regulatory mechanisms

Emerging research areas:

  • ZDHHC1's potential role in immune regulation (suggested by studies on other ZDHHC family members like ZDHHC11)

  • Interactions between ZDHHC1 and other post-translational modifications

  • Exploration of ZDHHC1's role in inflammatory conditions preceding cancer development

  • Investigation of potential non-enzymatic functions of ZDHHC1

What controls should be included when studying ZDHHC1 in experimental systems?

For robust ZDHHC1 research, incorporate these essential controls:

For protein detection:

  • Positive control: Recombinant ZDHHC1 protein (e.g., Human ZDHHC1 aa 104-151 fragment)

  • Negative control: Tissues/cells known to have low ZDHHC1 expression

  • Antibody validation: Pre-incubation with 100x molar excess of protein fragment

For functional studies:

  • ZDHHC1 knockout/knockdown models alongside wild-type controls

  • Catalytically inactive mutants (e.g., C158S mutation in the DHHC domain)

  • Rescue experiments with wild-type ZDHHC1 to confirm specificity of observed phenotypes

For palmitoylation assays:

  • Treatment with palmitoylation inhibitors (e.g., 2-bromopalmitate)

  • Active site cysteine mutants as negative controls

  • Acyl-RAC or metabolic labeling to confirm palmitoylation events

How should researchers address conflicting data regarding ZDHHC1 function in different experimental models?

When encountering conflicting results across experimental systems:

Systematic validation approach:

  • Verify expression levels and activity of ZDHHC1 in each model

  • Validate antibody specificity using recombinant proteins and knockdown controls

  • Consider tissue/cell-type specific differences in ZDHHC1 function

  • Examine genetic background variations that might influence ZDHHC1 activity

Contextual analysis:

  • Evaluate metabolic state differences between experimental models

  • Consider the tumor microenvironment when interpreting in vivo versus in vitro results

  • Assess potential compensatory mechanisms by other ZDHHC family members

Integrated data analysis:

  • Combine data from multiple experimental approaches (e.g., genomics, proteomics, metabolomics)

  • Perform meta-analysis of published studies to identify consistent patterns

  • Use pathway analysis to identify contextual differences in ZDHHC1 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.