Recombinant Human Probable palmitoyltransferase ZDHHC20 (ZDHHC20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage state, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ZDHHC20; Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; DHHC domain-containing cysteine-rich protein 20; DHHC20; Zinc finger DHHC domain-containing protein 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC20
Target Protein Sequence
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHL FFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTS ASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLL YCLFVAATVLEYFIKFWTNELTDTRAKFHVLFLFFVSAMFFISVLSLFSYHCWLVGKNRT TIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMD PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVT VAIEN
Uniprot No.

Target Background

Function
ZDHHC20 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It specifically catalyzes palmitoylation of cysteine residues within the cytoplasmic C-terminus of EGFR, thereby modulating the duration of EGFR signaling by influencing palmitoylation-dependent EGFR internalization and degradation. ZDHHC20 exhibits a preference for acyl-CoA with C16 fatty acid chains and can also utilize acyl-CoA with C14 and C18 fatty acid chains.
Gene References Into Functions
  1. The crystal structure of ZDHHC20 has been determined, revealing that the active site resides at the membrane-cytosol interface. The acyl chain binds within a cavity formed by the transmembrane domain. This structural information has enabled the proposal of a mechanism for acyl chain-length selectivity in DHHC enzymes based on cavity mutants with preferences for shorter and longer acyl chains. PMID: 29326245
  2. Targeting DHHC20, a peripheral modulator of EGFR signaling, leads to a loss of signal regulation and increased susceptibility to EGFR inhibitor-induced cell death. PMID: 27153536
  3. DHHC20 is a human N-terminal-myristoyl-directed palmitoyl acyltransferase involved in cellular transformation and may play a role in cancer. PMID: 20334580
Database Links

HGNC: 20749

KEGG: hsa:253832

STRING: 9606.ENSP00000371905

UniGene: Hs.564611

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is the basic function of ZDHHC20?

ZDHHC20 functions as a palmitoyl acyltransferase that catalyzes the S-acylation of proteins in a two-stage process: auto-S-acylation of the conserved cysteine in the DHHC motif by acyl-CoA (commonly palmitoyl-CoA), followed by S-acyl transfer to substrate protein cysteines. This post-translational modification plays integral roles in protein localization, stability, and function. ZDHHC20 is one of 23 known human ZDHHCs that collectively acylate over 3,000 cysteine residues across approximately 12% of the human proteome .

The enzymatic activity of ZDHHC20 is dependent on critical residues within its catalytic domain. Studies have shown that two residues, Cys156 and Phe171, in the acyl-binding cavity of ZDHHC20 are essential for its catalytic activity . This palmitoylation activity modifies downstream substrates, affecting their stability, localization, and function within the cell.

What is the structure and cellular localization of ZDHHC20?

ZDHHC20 contains a four-pass transmembrane (4TM) helix domain with a conical transmembrane lipid-binding pocket adjacent to the cytosolic catalytic site . The three-dimensional structure of ZDHHC20, as analyzed in previous research, confirms its two active sites involved in the palmitoylation modification process . This structural arrangement is critical for ZDHHC20's function as it creates a specific environment for substrate recognition and palmitoylation.

Regarding cellular localization, immunofluorescence confocal microscopy has shown that ZDHHC20 is predominantly localized in the cytoplasm, where it can interact with its substrates. For example, it has been observed to colocalize with YTHDF3 in the cytoplasm of pancreatic cancer cells .

How do researchers detect ZDHHC20-mediated protein palmitoylation?

Several methodological approaches are used to detect and analyze ZDHHC20-mediated palmitoylation:

  • Acyl-biotin exchange (ABE) assay: This technique allows for the detection of S-acylated proteins by replacing palmitoyl groups with biotin, enabling subsequent purification and identification of palmitoylated proteins .

  • Palmitoylation liquid chromatography-mass spectrometry analysis: This approach enables the identification of specific palmitoylated proteins and their modification sites. For example, this method identified 97 proteins with 123 cysteine sites that are palmitoylated in a ZDHHC20-dependent manner in hepatocellular carcinoma .

  • Chemical-genetic systems: Structure-guided engineering of paired ZDHHC "hole" mutants and "bumped" chemically tagged fatty acid probes enables selective labeling and identification of specific ZDHHC substrates. This approach has been applied to ZDHHC20 to identify its substrate networks .

What experimental models are commonly used to study ZDHHC20 function?

Researchers employ various experimental models to investigate ZDHHC20 function:

  • Cell line models: Human cancer cell lines such as PANC-1, BxPC-3, and CAPAN-1 (pancreatic cancer), and HEK-293 and Vero E6 (kidney-derived) are frequently used to study ZDHHC20 function through overexpression, knockdown, or knockout approaches .

  • Genetically engineered mouse models: ZDHHC20 knockout mice have been used to investigate the role of ZDHHC20 in cancer development. For example, in hepatocellular carcinoma (HCC), chemical carcinogen diethylnitrosamine (DEN)-induced and DEN combined CCl4 HCC models were used in ZDHHC20 knockout mice to investigate its role in HCC tumorigenesis .

  • Inducible expression systems: Tetracycline-inducible Halo-tagged ZDHHC20 has been developed to investigate the impact of targeted ZDHHC20 degradation on substrate palmitoylation .

What is known about ZDHHC20 substrate specificity and its major substrates?

ZDHHC20 exhibits substrate specificity despite the lack of a consensus sequence in protein substrates beyond the requirement for a free cysteine. Key identified substrates include:

  • YTHDF3: A m6A reader that interacts with ZDHHC20 in pancreatic cancer cells. Co-immunoprecipitation assays have confirmed the interaction between ZDHHC20 and YTHDF3, but not with related proteins YTHDF1 or YTHDF2, demonstrating substrate specificity .

  • Fatty Acid Synthase (FASN): ZDHHC20 palmitoylates FASN at cysteines 1471 and 1881, which protects FASN from degradation via the ubiquitin-proteasome pathway. This palmitoylation competes against ubiquitination mediated by the E3 ubiquitin ligase complex SNX8-TRIM28 .

  • IFITM3: ZDHHC20 has been shown to palmitoylate Interferon-induced transmembrane protein 3 (IFITM3). In HEK-derived FT-293 cells, Halo-ZDHHC20 degradation significantly diminished IFITM3 palmitoylation .

  • Other reported substrates: ZDHHC20 has also been reported to palmitoylate EGFR in breast and lung cancers, melanoma cell adhesion molecule (MCAM) in melanoma, and other proteins including NCAM1 and VAMP7 .

Chemical-genetic systems combined with proteomics have identified over 300 ZDHHC-specific substrates and S-acylation sites across various human cell lines, providing the first extended substrate networks for ZDHHC20 .

How does ZDHHC20 contribute to cancer progression and prognosis?

ZDHHC20 has been implicated in cancer progression through multiple mechanisms:

  • Pancreatic cancer: High expression levels of ZDHHC20 correlate with unfavorable prognosis in pancreatic cancer patients. Analysis of The Cancer Genome Atlas (TCGA) data and the Tumor Immune Estimation Resource (TIMER) database indicated that ZDHHC20 is a poor prognostic factor in pancreatic cancer. Immunohistochemical staining in tissue microarrays showed abnormally upregulated ZDHHC20 in tumor tissues compared to normal adjacent tissues (NATs) .

  • Tumor-promoting functions: Knockdown of ZDHHC20 in pancreatic cancer cells resulted in reduced cell proliferation, invasion, and migration. In vivo, ZDHHC20 knockdown led to lower tumor weight, smaller pancreatic neoplastic lesion area, and longer survival time in KPC mice .

  • Hepatocellular carcinoma (HCC): Knockout of ZDHHC20 significantly reduced hepatocarcinogenesis induced by chemical agents in HCC mouse models. ZDHHC20-mediated palmitoylation of FASN promoted FASN stabilization by blocking its ubiquitin-proteasome-related degradation, thereby contributing to HCC formation .

  • Other cancers: ZDHHC20 has been implicated in multiple tumors, including breast cancer, lung cancer, and melanoma, where it palmitoylates various substrates to promote cancer progression .

What methodological approaches have been developed to identify ZDHHC20-specific substrates?

Researchers have developed sophisticated approaches to identify ZDHHC20-specific substrates:

  • Chemical-genetic systems: Structure-guided engineering of ZDHHC20 "hole" mutants and "bumped" chemically tagged fatty acid probes enables selective labeling of ZDHHC20-specific substrates. This approach involves mutations distal to the DHHC active site to minimize interference with catalytic activity while creating steric complementation with matching "bumped" lipid probes .

  • Palmitoylation proteomics: Liquid chromatography-mass spectrometry analysis following palmitoylation enrichment has identified 97 proteins with 123 cysteine sites palmitoylated in a ZDHHC20-dependent manner in hepatocellular carcinoma .

  • Targeted degradation approaches: PROTAC (proteolysis-targeting chimeras) technology has been applied to specifically degrade ZDHHC20 and assess the impact on substrate palmitoylation. In HEK-derived FT-293 cells expressing Halo-tagged ZDHHC20, Halo-PROTAC-mediated degradation significantly diminished palmitoylation of its substrate IFITM3 .

How can researchers distinguish between ZDHHC20-specific palmitoylation and palmitoylation by other ZDHHC family members?

Distinguishing ZDHHC20-specific palmitoylation from that mediated by other ZDHHC family members presents a significant challenge due to potential redundancy and overlapping substrate specificity. Several strategies have been developed:

What are the challenges in developing specific inhibitors for ZDHHC20?

Developing specific inhibitors for ZDHHC20 faces several challenges:

  • Active site conservation: The extensive conservation of the ZDHHC-PAT active site across family members makes development of isoform-specific competitive inhibitors highly challenging .

  • Functional redundancy: The well-established degeneracy in the ZDHHC-PAT family means that in some settings, the activity of non-targeted ZDHHCs may substitute and preserve substrate palmitoylation, potentially limiting therapeutic efficacy .

  • Alternative approaches: Due to these challenges, researchers have explored alternative strategies such as PROTAC-mediated degradation of ZDHHC20. While this approach showed promise in HEK-derived FT-293 cells, its efficacy varied across cell types, highlighting the context-dependent nature of ZDHHC20 function .

How can recombinant ZDHHC20 be used in experimental settings?

Recombinant ZDHHC20 can be utilized in various experimental settings:

  • Structural studies: Human C-terminally Myc-FLAG-tagged ZDHHC20 has been used for structural analysis to understand the enzyme's mechanism and substrate binding properties .

  • Substrate identification: Recombinant ZDHHC20 can be used in in vitro palmitoylation assays to identify and validate potential substrates.

  • Interaction studies: Expression plasmids for HA-ZDHHC20 have been used in co-immunoprecipitation assays to detect interactions with potential substrate proteins such as Flag-YTHDF3 .

  • Functional studies: Ectopic transfection of ZDHHC20 expression plasmids in cells with relatively low endogenous ZDHHC20 expression (such as BxPC-3 and CAPAN-1 cells) has been used to investigate the functional consequences of ZDHHC20 overexpression .

What are the potential therapeutic implications of targeting ZDHHC20?

Given ZDHHC20's roles in cancer progression, it represents a potential therapeutic target:

  • Cancer therapy: Inhibiting ZDHHC20 could potentially suppress cancer progression in multiple tumor types. In pancreatic cancer, ZDHHC20 knockdown reduced tumor growth and extended survival in mouse models . Similarly, in HCC, genetic knockout or pharmacological inhibition of ZDHHC20 mitigated cancer formation in mouse models .

  • PROTAC approach: Targeted degradation of ZDHHC20 using PROTAC technology has shown promise in decreasing substrate palmitoylation in specific cellular contexts, suggesting a potential therapeutic strategy .

  • Combination therapies: ZDHHC20 may participate in pathways that could be targeted in combination with other therapies. For example, STAT3 inhibition combined with ZDHHC20 knockdown showed effects on tumor growth, suggesting potential for combination approaches .

What are the emerging areas of ZDHHC20 research?

Several emerging areas in ZDHHC20 research hold promise for future discoveries:

  • Comprehensive substrate mapping: The development of chemical-genetic systems for ZDHHC20 enables more comprehensive mapping of its substrate network across different tissues and disease states .

  • Regulatory mechanisms: Investigation of how ZDHHC20 expression and activity are regulated in normal and disease states. For example, STAT3 has been implicated in regulating ZDHHC20 expression in pancreatic cancer .

  • Cross-talk between PTMs: The interplay between ZDHHC20-mediated palmitoylation and other post-translational modifications, such as ubiquitination, represents an important area of investigation. For instance, ZDHHC20-mediated palmitoylation of FASN competes with ubiquitination mediated by the SNX8-TRIM28 complex .

  • Disease-specific roles: Further exploration of ZDHHC20's roles in different diseases beyond cancer, including potential implications in infectious diseases, as suggested by its palmitoylation of IFITM3 and potential effects on SARS-CoV-2 spike protein .

What controls should be included when studying ZDHHC20-mediated palmitoylation?

When studying ZDHHC20-mediated palmitoylation, several key controls should be included:

  • Catalytically inactive ZDHHC20 mutants: Mutations of critical residues in the acyl-binding cavity (e.g., Cys156 and Phe171) that abolish ZDHHC20's catalytic activity provide important negative controls for palmitoylation studies .

  • Palmitoylation inhibitors: 2-bromopalmitate (2-BP), a general inhibitor of protein palmitoylation, can be used to verify that observed effects are indeed due to palmitoylation. For example, 2-BP treatment counteracted the promotive effects of ZDHHC20 overexpression on cell proliferation and invasion in pancreatic cancer cells .

  • Substrate cysteine mutants: Mutation of putative palmitoylation sites in substrate proteins (e.g., C1471S/C1881S mutations in FASN) provides critical evidence for site-specific palmitoylation .

  • Other ZDHHC family members: Including other ZDHHC family members as comparators helps establish the specificity of ZDHHC20 for particular substrates.

How can researchers overcome technical challenges in ZDHHC20 expression and purification?

Expression and purification of membrane proteins like ZDHHC20 present technical challenges. Researchers can consider the following approaches:

  • Expression systems: Mammalian expression systems may better maintain ZDHHC20's native conformation and post-translational modifications compared to bacterial systems.

  • Tags and fusion proteins: The use of tags such as Myc-FLAG or Halo can facilitate purification and detection of ZDHHC20. Human C-terminally Myc-FLAG-tagged ZDHHC20 (C-FLAG-D20) has been successfully used in structural and functional studies .

  • Detergent selection: Careful selection of detergents for membrane protein solubilization is critical for maintaining ZDHHC20 structure and activity.

  • Inducible expression systems: Tetracycline-inducible systems for ZDHHC20 expression can help mitigate potential toxicity issues associated with constitutive overexpression .

What experimental designs best evaluate ZDHHC20 function in disease models?

To effectively evaluate ZDHHC20 function in disease models, researchers should consider:

  • Genetic manipulation approaches: Both loss-of-function (knockout/knockdown) and gain-of-function (overexpression) approaches provide complementary insights into ZDHHC20 function. For example, ZDHHC20 knockout significantly reduced hepatocarcinogenesis in HCC mouse models , while ZDHHC20 overexpression promoted pancreatic cancer cell proliferation, invasion, and migration .

  • In vivo models: Animal models with genetic manipulation of ZDHHC20 provide crucial insights into its role in disease progression. For example, ZDHHC20 knockdown in KPC mice resulted in smaller pancreatic neoplastic lesions and longer survival .

  • Patient-derived samples: Analysis of ZDHHC20 expression in patient samples and correlation with clinical outcomes provides translational relevance. High ZDHHC20 expression correlated with unfavorable prognosis in pancreatic cancer patients .

  • Substrate validation: Comprehensive identification and validation of ZDHHC20 substrates in disease models helps elucidate mechanisms of disease progression. For example, ZDHHC20-mediated palmitoylation of FASN promoted HCC formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.