Recombinant Human Probable palmitoyltransferase ZDHHC23 (ZDHHC23)

Shipped with Ice Packs
In Stock

Description

Key Biological Roles and Substrates

ZDHHC23 palmitoylates specific protein substrates, influencing diverse cellular processes:

Tumor Progression and Metabolism

  • PHF2 Degradation: ZDHHC23 palmitoylates PHF2, promoting its ubiquitination and proteasomal degradation. This reduces PHF2-mediated repression of SREBP1c, enhancing lipid biosynthesis in hepatocellular carcinoma (HCC) .

  • Neuroblastoma (NB) Aggressiveness: Overexpression of ZDHHC23 in NB correlates with poor prognosis, potentially via cytoskeletal reorganization and extracellular vesicle regulation .

Immune Regulation

  • Macrophage Polarization: In teleosts, ZDHHC23 promotes M2-type macrophage polarization, suppressing pro-inflammatory cytokines (e.g., IL-6, TNF-α) and inhibiting necroptosis during bacterial infections .

  • Astrocyte Activation: In rodent models, ZDHHC23 palmitoylates glial fibrillary acidic protein (GFAP), enhancing astrocyte viability and inflammatory factor release (e.g., CXCL-10, GM-CSF), contributing to neuropathic pain .

Neural and Synaptic Function

  • NOS1 and KCNMA1 Targeting: ZDHHC23 palmitoylates neuronal nitric oxide synthase (NOS1) and the potassium channel KCNMA1, regulating synaptic signaling and membrane localization .

Experimental Models

ApplicationMethodOutcomeSource
Cancer StudiessiRNA knockdown in HCC cellsReduced PHF2 palmitoylation, increased SREBP1c activity, lipid accumulation
Pain ResearchGFAP-C291A mutant + ZDHHC23 inhibition in astrocytesAttenuated GFAP palmitoylation, reduced IL-6 secretion, pain relief
Immune ModulationLczDHHC23 knockdown in teleost macrophagesShift to M1 polarization, increased pro-inflammatory cytokines

Therapeutic Targets

  • Cancer Therapy: Inhibiting ZDHHC23 may suppress lipid reprogramming in HCC by stabilizing PHF2 .

  • Pain Management: Targeting GFAP palmitoylation via ZDHHC23-specific inhibitors could alleviate neuropathic pain .

  • Immune Diseases: Modulating ZDHHC23 activity may balance macrophage polarization in inflammatory disorders .

Challenges and Future Directions

  • Specificity Challenges: Current palmitoylation inhibitors (e.g., 2-bromopalmitate) lack selectivity for ZDHHC23. Engineered orthogonal substrates or peptide competitors may improve targeting .

  • Structural Insights: High-resolution structures of ZDHHC23-substrate complexes are needed to design isoform-specific inhibitors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC23; Palmitoyltransferase ZDHHC23; Zinc finger DHHC domain-containing protein 23; DHHC-23; zDHHC23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC23
Target Protein Sequence
MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKS LQPETCERIMDTISDRLRIPWLRGAKKVNISIIPPLVLLPVFLHVASWHFLLGVVVLTSL PVLALWYYYLTHRRKEQTLFFLSLGLFSLGYMYYVFLQEVVPKGRVGPVQLAVLTCGLFL ILLALHRAKKNPGYLSNPASGDRSLSSSQLECLSRKGQEKTKGFPGADMSGSLNNRTTKD DPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESN HQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSALSFTCVWYSVI ITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGLLG
Uniprot No.

Target Background

Function
This palmitoyltransferase catalyzes the addition of palmitate to various protein substrates, playing a role in diverse cellular processes. It mediates the palmitoylation of KCNMA1, regulating its localization to the plasma membrane. This enzyme may also be involved in NOS1 regulation and targeting to the synaptic membrane.
Database Links

HGNC: 28654

OMIM: 617334

KEGG: hsa:254887

STRING: 9606.ENSP00000330485

UniGene: Hs.21902

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC23 and what is its primary function?

ZDHHC23 is a member of the zinc finger DHHC domain-containing (ZDHHC) protein family that functions as a palmitoyltransferase (PAT). Its primary function is to catalyze the addition of palmitoyl groups to specific protein substrates, a process known as protein S-palmitoylation. This post-translational modification affects protein localization, stability, and function by increasing hydrophobicity and facilitating membrane association.

In mammals, ZDHHC23 primarily palmitoylates molecules implicated in mTOR signaling and tumorigenesis . This enzymatic activity involves the transfer of a 16-carbon palmitoyl group from palmitoyl-CoA to cysteine residues on target proteins through a thioester bond. The highly conserved DHHC motif within the catalytic domain is essential for this enzymatic function.

How does ZDHHC23 differ from other ZDHHC family members?

ZDHHC23 is one of 23 ZDHHC family members in humans, each with distinct substrate specificities, tissue distribution patterns, and cellular localizations. While all ZDHHC proteins contain the characteristic DHHC catalytic domain, they differ in their substrate preference and biological functions.

Studies have shown that ZDHHC23 is specifically upregulated in certain cancer types, particularly gliomas, where increased expression correlates with the severity of malignancy . Unlike some other ZDHHC proteins that may function as tumor suppressors (such as ZDHHC7, ZDHHC13, and ZDHHC14), ZDHHC23 appears to have oncogenic properties in glioma .

Additionally, ZDHHC23 shows unique expression patterns in different glioma subtypes, with increased expression specifically in the proneural subtype, which is associated with neuronal differentiation and better clinical outcomes . This contrasts with other ZDHHC proteins like ZDHHC18, which shows increased expression in the more aggressive mesenchymal subtype .

What experimental approaches are commonly used to study ZDHHC23 expression?

For investigating ZDHHC23 expression at the transcriptional level, researchers typically employ:

  • Quantitative real-time PCR (qRT-PCR) to measure mRNA expression levels

  • RNA sequencing (RNA-seq) for genome-wide expression analysis

  • In situ hybridization for spatial localization in tissues

At the protein level, common methods include:

  • Western blotting using ZDHHC23-specific antibodies

  • Immunohistochemistry (IHC) or immunofluorescence for tissue or cellular localization

  • Mass spectrometry-based proteomics for quantitative protein analysis

For example, studies examining ZDHHC23 in glioma utilized comparative expression analysis between tumor tissue and adjacent normal brain tissue, revealing significantly elevated ZDHHC23 levels in cancerous samples . Similar approaches can be used when studying ZDHHC23 in other contexts, such as in immune cells or other cancer types.

What techniques are most effective for studying ZDHHC23 palmitoylation activity?

Several complementary approaches are recommended for comprehensively analyzing ZDHHC23 palmitoylation activity:

  • Metabolic labeling with palmitate analogs: This involves incubating cells with alkyne or azide-modified palmitate analogs (e.g., 17-octadecynoic acid), followed by click chemistry to attach reporter tags for visualization or enrichment of palmitoylated proteins.

  • Acyl-biotin exchange (ABE) assay: This biochemical method involves:

    • Blocking free thiols with N-ethylmaleimide

    • Cleaving thioester bonds with hydroxylamine

    • Labeling newly exposed thiols with biotin-HPDP

    • Enriching biotinylated proteins with streptavidin

    • Analyzing by western blot or mass spectrometry

  • Acyl-resin-assisted capture (Acyl-RAC): A variation of ABE that uses thiopropyl sepharose resin instead of biotin-streptavidin.

  • Direct in vitro palmitoylation assays: Using purified recombinant ZDHHC23 protein with potential substrates and radiolabeled or clickable palmitoyl-CoA.

  • ZDHHC23 knockdown or overexpression: Manipulating ZDHHC23 expression in cellular models, followed by global palmitoylation profiling to identify affected substrates.

For RNA interference specifically targeting ZDHHC23, approaches used in model systems include transfection of ZDHHC23-specific siRNA using transfection reagents like Lipofectamine RNAiMAX, with appropriate scrambled siRNA controls . Optimal knockdown efficiency can be achieved by transfecting cells for 24-48 hours prior to downstream analyses .

How can researchers investigate ZDHHC23's role in cancer progression?

To investigate ZDHHC23's role in cancer progression, researchers should employ a multi-faceted approach:

  • Expression analysis in clinical samples:

    • Compare ZDHHC23 expression between tumor and matched normal tissues

    • Correlate expression levels with clinical parameters (stage, grade, survival)

    • Analyze expression in different cancer subtypes (e.g., proneural vs. mesenchymal glioma)

  • Functional studies in cancer cell lines:

    • ZDHHC23 knockdown using siRNA or CRISPR-Cas9

    • ZDHHC23 overexpression using expression vectors

    • Assess effects on:

      • Proliferation (MTT, BrdU incorporation)

      • Migration/invasion (transwell, wound healing)

      • Apoptosis (Annexin V/PI staining, TUNEL)

      • Colony formation

      • Tumor sphere formation (for cancer stem cells)

  • Identification of ZDHHC23 substrates in cancer:

    • Palmitoylation profiling after ZDHHC23 manipulation

    • Co-immunoprecipitation to identify interacting partners

    • Proteomic approaches to identify palmitoylated proteins

  • In vivo studies:

    • Xenograft models with ZDHHC23-modulated cancer cells

    • Patient-derived xenografts

    • Genetically engineered mouse models

What is the role of ZDHHC23 in immune regulation and inflammation?

Recent research has revealed ZDHHC23's significant immunomodulatory functions, particularly in macrophage polarization and inflammatory responses:

  • Anti-inflammatory effects:

    • ZDHHC23 silencing leads to heightened pro-inflammatory cytokine expression and diminished anti-inflammatory cytokine levels during infection

    • This indicates ZDHHC23 normally serves an anti-inflammatory role

  • Macrophage polarization:

    • ZDHHC23 facilitates M2-type (anti-inflammatory) macrophage polarization

    • Knockdown of ZDHHC23 skews macrophages toward the pro-inflammatory M1 phenotype

    • This was demonstrated in the large yellow croaker immune system but likely applies to mammalian systems

  • Regulation of cell death pathways:

    • ZDHHC23 influences necroptosis in infected immune cells

    • It regulates the phosphorylation of necroptosis markers including receptor-interacting serine/threonine kinase (RIP)1, RIP3, and mixed lineage kinase domain-like (MLKL)

Experimental approaches to study these functions include:

  • RNA interference to silence ZDHHC23 in macrophages/monocytes

  • Macrophage polarization assays using LPS (for M1) or cAMP (for M2)

  • Analysis of cytokine expression profiles

  • Assessment of phagocytic activity

  • Evaluation of cell death markers

These findings suggest ZDHHC23 may represent a potential therapeutic target for immune modulation, particularly in inflammatory conditions where promoting M2 polarization could be beneficial .

What contradictions exist in the current literature regarding ZDHHC23 function?

The current literature on ZDHHC23 presents several contradictions and knowledge gaps that researchers should be aware of:

  • Cancer role ambiguity:

    • While ZDHHC23 shows elevated expression in glioma, suggesting an oncogenic role , functional evidence directly linking this expression to cancer progression is limited

    • The specific mechanisms by which ZDHHC23 might contribute to oncogenesis remain largely uncharacterized

  • Context-dependent functions:

    • ZDHHC23 appears to have anti-inflammatory roles in immune cells , but potentially pro-tumorigenic roles in cancer cells

    • This raises questions about whether ZDHHC23 functions in a cell type-specific manner

  • Substrate specificity:

    • While ZDHHC23 is known to palmitoylate molecules involved in mTOR signaling and tumorigenesis , the complete repertoire of its substrates across different cell types remains undefined

    • How substrate specificity is determined and regulated is not fully understood

  • Non-enzymatic functions:

    • Recent findings suggest some ZDHHC proteins have functions independent of their palmitoyltransferase activity

    • Whether ZDHHC23 has such non-PAT functions, particularly in immune regulation, requires further investigation

Addressing these contradictions will require comprehensive studies combining biochemical, cellular, and in vivo approaches to fully characterize ZDHHC23's functions in different physiological and pathological contexts.

How can ZDHHC23 be targeted therapeutically in disease contexts?

Based on current understanding of ZDHHC23 functions, several therapeutic strategies could be explored:

  • For cancer applications:

    • Small molecule inhibitors specifically targeting ZDHHC23 enzymatic activity

    • RNA interference approaches (siRNA, shRNA) to downregulate ZDHHC23 expression

    • Identification and targeting of ZDHHC23-dependent pathways

    • Combination therapies coupling ZDHHC23 inhibition with standard treatments

  • For inflammatory conditions:

    • ZDHHC23 activators or expression enhancers to promote its anti-inflammatory effects

    • Cell-based therapies using macrophages with optimized ZDHHC23 expression

    • Targeting specific ZDHHC23-regulated pathways in immune cells

  • Targeted delivery approaches:

    • Nanoparticle-mediated delivery of ZDHHC23 modulators to specific tissues

    • Cell type-specific expression systems for precision targeting

What are the recommended experimental controls when working with recombinant ZDHHC23?

When working with recombinant human ZDHHC23, researchers should implement the following controls to ensure experimental validity:

  • For protein expression and purification:

    • Expression of catalytically inactive ZDHHC23 mutant (DHHS instead of DHHC)

    • Empty vector control

    • Non-related protein of similar size/structure

    • Tag-only control if using tagged recombinant protein

  • For palmitoylation assays:

    • No-enzyme control

    • Heat-inactivated enzyme control

    • Palmitate analog without click chemistry reagents

    • Hydroxylamine-resistant controls (non-palmitoylated proteins)

  • For cellular studies:

    • Scrambled siRNA control for knockdown experiments

    • Empty vector for overexpression studies

    • Wild-type cells alongside genetically modified lines

    • Treatment with global palmitoylation inhibitors (e.g., 2-bromopalmitate) as a positive control

  • For functional assays:

    • Time course experiments to identify optimal time points

    • Dose-response studies for any treatments

    • Multiple cell lines to ensure reproducibility across different genetic backgrounds

These controls are essential for distinguishing ZDHHC23-specific effects from background and ensuring the reliability and reproducibility of experimental findings.

ZDHHC23 in Disease and Development

The mechanistic relationship between ZDHHC23 and mTOR signaling represents an important area of investigation:

  • Current understanding:

    • In mammals, ZDHHC23 primarily palmitoylates molecules implicated in mTOR signaling

    • This suggests ZDHHC23 may regulate cellular metabolism, growth, and proliferation through this pathway

  • Potential mechanisms:

    • ZDHHC23 may directly palmitoylate components of the mTOR complex

    • Alternatively, it might palmitoylate upstream regulators or downstream effectors of mTOR

    • Palmitoylation could affect protein localization, stability, or interaction capabilities

  • Experimental approaches to investigate this connection:

    • Palmitoylation assays of mTOR pathway components in the presence/absence of ZDHHC23

    • Pharmacological inhibition of mTOR in models with ZDHHC23 modulation

    • Phosphorylation analysis of mTOR substrates (e.g., S6K, 4E-BP1) after ZDHHC23 manipulation

    • Co-immunoprecipitation studies to identify physical interactions

This connection to mTOR signaling may partially explain ZDHHC23's potential oncogenic properties, as mTOR hyperactivation is a common feature in many cancers. Further research is needed to fully characterize the specific mTOR-related substrates of ZDHHC23 and the functional consequences of their palmitoylation.

What cutting-edge technologies could advance ZDHHC23 research?

Several emerging technologies offer promising avenues for deeper insights into ZDHHC23 biology:

  • Proteomics approaches:

    • Proximity labeling methods (BioID, APEX) to identify the ZDHHC23 interactome

    • Global palmitoylome analysis using metabolic labeling and quantitative proteomics

    • Top-down proteomics to analyze intact ZDHHC23 with post-translational modifications

  • Structural biology techniques:

    • Cryo-electron microscopy to determine ZDHHC23 structure with substrates

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Computational modeling and molecular dynamics simulations

  • Single-cell technologies:

    • Single-cell RNA-seq to analyze ZDHHC23 expression heterogeneity in tissues

    • Single-cell proteomics to examine ZDHHC23 protein levels and modifications

    • Spatial transcriptomics to map ZDHHC23 expression in complex tissues

  • Gene editing and screening:

    • CRISPR-Cas9 screens to identify synthetic lethal interactions with ZDHHC23

    • Base editing or prime editing for precise modification of ZDHHC23

    • CRISPR activation/inhibition systems for reversible ZDHHC23 modulation

These technologies could help resolve current contradictions in the literature and uncover novel functions and regulatory mechanisms of ZDHHC23 that are not apparent using conventional approaches.

What collaborative research approaches would benefit ZDHHC23 investigation?

Advancing ZDHHC23 research would benefit from multidisciplinary collaborations:

  • Integrative teams combining expertise in:

    • Biochemistry and enzymology (for mechanism studies)

    • Cell biology (for cellular function studies)

    • Immunology (for immune regulation studies)

    • Cancer biology (for oncogenic potential studies)

    • Structural biology (for protein structure determination)

    • Medicinal chemistry (for inhibitor development)

  • Multi-organism approaches:

    • Comparative studies across species (e.g., human, mouse, zebrafish, large yellow croaker)

    • Translation of findings from model organisms to human systems

  • Clinical-basic science partnerships:

    • Biobanking initiatives for human samples

    • Patient-derived models (organoids, xenografts)

    • Correlative studies linking ZDHHC23 to clinical outcomes

  • Public-private partnerships:

    • Academic-industry collaborations for drug development

    • Shared resources and technology platforms

By adopting these collaborative approaches, researchers can accelerate progress in understanding ZDHHC23 biology and developing therapeutic applications targeting this enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.