Recombinant Human Probable palmitoyltransferase ZDHHC24 (ZDHHC24)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Substrate Specificity

ZDHHC24 catalyzes S-palmitoylation by transferring palmitate from palmitoyl-CoA to target proteins. Key features include:

  • Acyl-CoA Selectivity: Prefers C16:0 (palmitate) but may accommodate longer-chain fatty acids depending on hydrophobic cavity architecture .

  • Substrate Recruitment: Lacks consensus sequence motifs; specificity is determined by accessory proteins and ankyrin-repeat domains .

  • Auto-palmitoylation: Requires self-modification at the catalytic cysteine for activation .

Role in Cancer Biology

ZDHHC24 is upregulated in lung adenocarcinoma (LUAD) and correlates with poor prognosis :

  • Immune Microregulation: High ZDHHC24 expression associates with increased infiltration of CD8+ T cells, macrophages, and dendritic cells .

  • Therapeutic Target: Linked to immune checkpoint gene CD276, suggesting potential for immunotherapy .

Functional Assays and Mutational Analysis

  • Auto-palmitoylation Assay: A fluorescence-based method using NBD-palmitoyl-CoA confirmed ZDHHC24’s enzymatic activity in native membranes .

  • Cancer-Associated Mutations: Mutations in hydrophobic TMD residues (e.g., P104S in zDHHC4) disrupt acyl-CoA binding, reducing activity .

Table 2: Clinical Associations of ZDHHC24 in LUAD

ParameterFindingSource
mRNA ExpressionUpregulated in tumor vs. normal tissue
Survival CorrelationHigh expression linked to shorter OS
Immune InfiltrationPositively correlates with CD8+ T cells

Applications in Research and Therapeutics

  • Recombinant Production: Available in E. coli, yeast, and mammalian systems with ≥85% purity . Used to study palmitoylation mechanisms and screen inhibitors .

  • Chemical-Genetic Systems: Enable proteome-wide mapping of ZDHHC24 substrates, revealing roles in neuronal plasticity and cancer pathways .

Future Directions

  • Structural Studies: Resolving ZDHHC24’s crystal structure could clarify its unique five-TMD topology .

  • Therapeutic Targeting: Inhibitors targeting ZDHHC24’s CRD or C-terminal tail may disrupt oncogenic signaling in LUAD .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC24; UNQ2528/PRO6027; Probable palmitoyltransferase ZDHHC24; Zinc finger DHHC domain-containing protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC24
Target Protein Sequence
MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAF QLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRR DHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLP WLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLG PCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS
Uniprot No.

Target Background

Function
Probable palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  2. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
Database Links

HGNC: 27387

KEGG: hsa:254359

STRING: 9606.ENSP00000309429

UniGene: Hs.659933

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC24 and how does it relate to the broader ZDHHC family?

ZDHHC24 (zinc finger DHHC-type containing 24) is a probable palmitoyltransferase belonging to the DHHC palmitoyltransferase family . The ZDHHC family includes 23 well-characterized human zinc finger Asp-His-His-Cys motif-containing (ZDHHC) S-acyltransferases that catalyze long-chain S-acylation at cysteine residues across hundreds of proteins . Though ZDHHC24 is classified as "probable," suggesting its enzymatic activity hasn't been fully confirmed experimentally, its sequence homology and structural characteristics support its classification within this family.

The ZDHHC enzyme catalytic cycle typically occurs in two stages: auto-S-acylation of a conserved cysteine in the DHHC motif by acyl-CoA (commonly palmitoyl-CoA) with release of CoA-SH, followed by S-acyl transfer to a substrate protein cysteine proximal to the ZDHHC catalytic site . This mechanism likely applies to ZDHHC24 as well, though specific substrate preferences may differ from other family members.

What are the known functional partners of ZDHHC24?

Based on protein interaction prediction analyses, ZDHHC24 has several potential functional partners, with the strongest predicted associations being:

Protein PartnerDescriptionInteraction Score
PBDC1Polysaccharide biosynthesis domain containing 10.570
ZDHHC12Probable palmitoyltransferase ZDHHC120.567

These interaction scores represent the confidence of the predicted functional associations based on various lines of evidence including neighborhood analysis, gene fusion, co-occurrence, co-expression, experimental data, databases, and text mining . Other ZDHHC family members have well-characterized protein interactions – for example, ZDHHC6 mediates palmitoylation of proteins such as AMFR, CALX, ITPR1, and TFRC . Similar systematic studies for ZDHHC24-specific interactions would help elucidate its functional network.

How is the ZDHHC24 gene structured and what are its expression patterns?

The ZDHHC24 gene encodes a protein of 284 amino acids in humans . While direct expression data for ZDHHC24 isn't provided in the search results, we can gain insights from studies of other ZDHHC family members. Various ZDHHCs demonstrate tissue-specific and disease-state-dependent expression patterns. For example, in kidney renal clear cell carcinoma (KIRC), multiple ZDHHC family members show altered expression compared to normal tissues, with some being significantly down-regulated (ZDHHC2, 3, 6, 14, 15, 21, 23) and others up-regulated (ZDHHC9, 17, 18, 19, 20) .

To properly characterize ZDHHC24 expression, researchers should consider:

  • RNA-seq analysis across various tissues and cell types

  • Protein-level confirmation using western blot or immunohistochemistry

  • Assessment of expression changes in disease states and developmental stages

What experimental approaches are most effective for studying ZDHHC24 substrates?

Identifying the substrate proteins of specific ZDHHC enzymes presents a significant research challenge. A cutting-edge technology directly applicable to ZDHHC24 research is the chemical-genetic system developed for mapping ZDHHC substrates at the whole-proteome level in intact cells .

This methodology involves:

  • Structure-guided engineering of ZDHHC "hole" mutants that can accept modified substrates

  • Design of "bumped" chemically tagged fatty acid probes that selectively work with the engineered enzyme

  • Transfer of these probes to specific protein substrates with high selectivity

  • Proteomic analysis to identify labeled substrates

This system has been successfully implemented for five human ZDHHCs (3, 7, 11, 15, and 20), identifying over 300 substrates and S-acylation sites . Adapting this approach for ZDHHC24 would require:

  • Engineering equivalent mutations in the ZDHHC24 catalytic domain

  • Validating probe compatibility and selectivity

  • Optimizing cellular expression systems

  • Implementing appropriate proteomics pipelines for substrate identification

This approach offers significant advantages over traditional methods by enabling direct substrate mapping under physiological conditions with excellent specificity.

How might ZDHHC24 function be implicated in disease processes?

While specific roles for ZDHHC24 in disease aren't detailed in the search results, research on other ZDHHC family members provides valuable context for investigating potential ZDHHC24 involvement in pathological processes.

For example, multiple ZDHHC family members show prognostic significance in kidney renal clear cell carcinoma (KIRC):

To investigate ZDHHC24's potential role in disease:

  • Analyze expression patterns across disease databases (e.g., TCGA, GEO)

  • Evaluate correlations between ZDHHC24 expression/mutations and clinical outcomes

  • Implement loss-of-function and gain-of-function approaches in disease models

  • Identify disease-relevant substrates using the chemical-genetic system

  • Assess potential correlations with immune cell infiltration (as observed with other ZDHHCs)

This systematic approach would help determine whether ZDHHC24 has potential as a prognostic marker or therapeutic target in specific diseases.

How do post-translational modifications regulate ZDHHC24 activity?

The regulation of ZDHHC enzyme activity through post-translational modifications (PTMs) represents an important area of investigation. While specific PTMs affecting ZDHHC24 aren't detailed in the search results, understanding the general regulatory mechanisms of ZDHHC enzymes provides a framework for studying ZDHHC24 regulation.

Potential PTMs that may regulate ZDHHC24 include:

  • Phosphorylation: May alter enzyme activity, substrate specificity, or localization

  • Ubiquitination: Could influence protein stability and turnover

  • S-acylation: Self-palmitoylation or palmitoylation by other ZDHHCs

  • Other modifications: SUMOylation, acetylation, methylation, etc.

Research approaches to characterize ZDHHC24 PTMs should include:

  • Mass spectrometry-based PTM mapping under various cellular conditions

  • Site-directed mutagenesis of putative modification sites

  • Assessment of how modifications impact enzyme activity, localization, and substrate recognition

  • Identification of upstream regulators (kinases, phosphatases, etc.)

Understanding these regulatory mechanisms would provide insights into how ZDHHC24 activity is dynamically controlled in response to cellular signals and environmental conditions.

What expression systems are optimal for producing recombinant ZDHHC24 for biochemical studies?

Producing functional recombinant ZDHHC24 presents unique challenges due to its membrane-associated nature. Based on approaches used for other ZDHHC family members, the following expression systems should be considered:

  • Mammalian cell expression systems:

    • HEK293, COS-7, or CHO cells maintain proper folding and post-translational modifications

    • Consider inducible expression systems (e.g., Tet-On) to control expression levels

    • Tagged constructs (His, FLAG, etc.) facilitate purification while maintaining activity

  • Insect cell expression systems:

    • Baculovirus-infected Sf9 or High Five cells often yield higher amounts of functional membrane proteins

    • May provide better yield-to-functionality ratio than bacterial systems

  • Cell-free expression systems:

    • Useful for rapid screening of constructs and conditions

    • Can be supplemented with lipids/detergents to support membrane protein folding

For optimal results, researchers should:

  • Include proper signal sequences and transmembrane domains

  • Consider truncated constructs removing potentially disordered regions

  • Implement solubilization strategies using mild detergents (DDM, CHAPS, etc.)

  • Validate enzyme activity using established palmitoyltransferase assays

When working with ZDHHC24 specifically, cDNA ORF clones are commercially available starting from $99.00 , providing a convenient starting point for construct design and optimization.

What assay methods can accurately measure ZDHHC24 palmitoyltransferase activity?

Measuring the enzymatic activity of ZDHHC24 is essential for characterizing its function. Several complementary approaches can be implemented:

  • Radiolabeling assays:

    • Incubate purified or immunoprecipitated ZDHHC24 with [³H]palmitoyl-CoA and potential substrates

    • Analyze incorporation by SDS-PAGE and fluorography

    • Advantages: high sensitivity; Limitations: handling radioactive materials

  • Click chemistry-based assays:

    • Use alkyne/azide-modified fatty acid analogs (e.g., 17-ODYA)

    • Conjugate fluorophores or biotin via click chemistry

    • Visualize/quantify using in-gel fluorescence or streptavidin pull-down

    • Advantages: no radioactivity, compatibility with proteomics

  • Acyl-biotin exchange (ABE):

    • Block free thiols, cleave thioester bonds, label newly exposed thiols

    • Detect palmitoylated proteins via western blot or mass spectrometry

    • Advantages: works with endogenous proteins; Limitations: not direct measurement of enzyme activity

  • Fluorescence-based assays:

    • Measure CoA-SH release using thiol-reactive fluorophores

    • Real-time monitoring of enzyme kinetics

    • Advantages: continuous assay format; Limitations: potential interference

For ZDHHC24 specifically, researchers should first validate activity using known substrates of related ZDHHC enzymes before proceeding to substrate discovery approaches.

What bioinformatic approaches can predict potential ZDHHC24 substrates?

Computational prediction of ZDHHC24 substrates can guide experimental efforts. Several bioinformatic approaches can be utilized:

  • Sequence-based prediction:

    • Analyze potential substrate proteins for exposed cysteine residues

    • Evaluate local sequence context for features favorable to palmitoylation

    • Utilize prediction algorithms such as CSS-Palm, NBA-Palm, or GPS-Lipid

  • Structural modeling:

    • Generate structural models of ZDHHC24 using homology modeling based on known ZDHHC structures

    • Perform molecular docking to assess potential substrate binding

    • Molecular dynamics simulations to evaluate enzyme-substrate interactions

  • Co-expression network analysis:

    • Identify proteins whose expression patterns correlate with ZDHHC24 across tissues/conditions

    • Proteins showing strong co-expression may represent functional partners or substrates

    • Integrate with protein interaction databases for higher confidence predictions

  • Evolutionary conservation analysis:

    • Examine conservation of cysteine residues across species

    • Conserved cysteines in membrane-proximal regions are strong candidates for palmitoylation

    • Compare with known substrates of other ZDHHC family members

The STRING database already provides some predicted functional partners for ZDHHC24, with PBDC1 and ZDHHC12 showing the strongest association scores (0.570 and 0.567 respectively) . These predictions serve as a starting point for further computational and experimental validation.

How can CRISPR-Cas9 approaches be optimized for studying ZDHHC24 function?

CRISPR-Cas9 technology offers powerful approaches for investigating ZDHHC24 function through precise genetic manipulation. Based on successful applications with other ZDHHC family members, the following strategies are recommended:

  • Complete knockout studies:

    • Design multiple sgRNAs targeting early exons of ZDHHC24

    • Validate knockouts at DNA (sequencing), RNA (qPCR), and protein (western blot) levels

    • Assess phenotypic consequences across multiple cell types/models

    • Consider potential compensation by other ZDHHC family members

  • Domain-specific mutagenesis:

    • Use homology-directed repair to introduce point mutations in catalytic domains

    • Create DHHC → DHHS mutations to generate catalytically inactive variants

    • Assess effects on enzyme activity and substrate palmitoylation

  • Endogenous tagging:

    • Insert epitope tags or fluorescent proteins at the N/C-terminus

    • Enables tracking of endogenous protein without overexpression artifacts

    • Validate that tagging doesn't interfere with enzymatic activity

  • Inducible/conditional systems:

    • Implement Cre-lox or doxycycline-inducible CRISPR systems

    • Allows temporal control of ZDHHC24 disruption

    • Helps distinguish acute from compensatory effects

  • Multiplexed approaches:

    • Simultaneously target ZDHHC24 and related family members

    • Addresses potential functional redundancy

    • May reveal synergistic relationships between different ZDHHCs

For phenotypic analysis, researchers should focus on cellular processes known to be regulated by protein S-acylation, including membrane trafficking, protein stability, and signal transduction pathways.

What considerations are important when designing experiments to study ZDHHC24 localization and trafficking?

Understanding the subcellular localization and trafficking of ZDHHC24 is crucial for elucidating its function. Several experimental approaches and considerations are recommended:

  • Imaging approaches:

    • Immunofluorescence using specific antibodies against endogenous ZDHHC24

    • Live-cell imaging using fluorescent protein fusions (ensure tagging doesn't disrupt localization)

    • Super-resolution microscopy to resolve detailed subcellular structures

    • Co-localization studies with established organelle markers

  • Biochemical fractionation:

    • Differential centrifugation to separate major cellular compartments

    • Density gradient fractionation for higher resolution separation

    • Western blotting of fractions to track ZDHHC24 distribution

    • Compare distribution patterns under various cellular conditions

  • Trafficking dynamics:

    • Photoactivatable or photoconvertible tags to track protein movement

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Study effects of trafficking inhibitors (Brefeldin A, nocodazole, etc.)

    • Examine responses to cellular stressors or signaling events

  • Localization determinants:

    • Mutational analysis of potential localization signals

    • Chimeric constructs with other ZDHHC family members

    • Assess impacts of post-translational modifications on localization

    • Identify interacting proteins that may influence localization

Based on studies of other ZDHHC family members, it's likely that ZDHHC24 localizes to specific membrane compartments such as the ER, Golgi apparatus, or plasma membrane, which would influence its substrate accessibility and function.

What model systems are most appropriate for studying ZDHHC24 function in development and disease?

Selecting appropriate model systems is critical for translating molecular findings to physiological and pathological contexts. Several models offer complementary advantages for ZDHHC24 research:

  • Cell culture models:

    • Selection should be based on endogenous ZDHHC24 expression levels

    • Include both normal and disease-relevant cell types

    • Primary cells may provide more physiologically relevant context than immortalized lines

    • 3D organoid systems better recapitulate tissue architecture and function

  • Mouse models:

    • Global or conditional Zdhhc24 knockout mice

    • Knock-in models with catalytically inactive mutations

    • Reporter models to track expression patterns during development

    • Disease-specific models to assess contributions to pathogenesis

  • Non-mammalian models:

    • Zebrafish offer advantages for developmental studies and high-throughput screening

    • Drosophila has fewer ZDHHC genes, potentially reducing functional redundancy

    • C. elegans provides simplified systems for genetic interaction studies

  • Human-derived systems:

    • Patient-derived cells or tissues with altered ZDHHC24 expression/function

    • iPSC-derived specialized cell types for disease modeling

    • CRISPR-engineered isogenic lines differing only in ZDHHC24 status

When studying disease relevance, researchers should consider that altered expression of various ZDHHC family members has been associated with cancer prognosis. For example, in kidney renal clear cell carcinoma, expression of several ZDHHCs correlates significantly with patient survival and disease progression , suggesting similar analyses could reveal important roles for ZDHHC24.

How can knowledge of ZDHHC24 substrates inform therapeutic development?

Understanding ZDHHC24 substrates provides potential avenues for therapeutic intervention, particularly if ZDHHC24-mediated palmitoylation regulates disease-relevant proteins. Several approaches leverage this knowledge:

  • Target identification:

    • Identify disease-associated proteins regulated by ZDHHC24-mediated palmitoylation

    • Determine whether palmitoylation enhances or inhibits pathogenic functions

    • Prioritize targets based on druggability and disease relevance

  • Inhibitor development:

    • Structure-based design of ZDHHC24-specific inhibitors

    • High-throughput screening approaches using recombinant enzyme

    • Development of substrate-mimetic peptides that competitively inhibit specific palmitoylation events

    • Evaluation of pan-ZDHHC inhibitors versus selective ZDHHC24 inhibitors

  • Therapeutic repurposing:

    • Assess existing drugs for effects on ZDHHC24 activity or substrate palmitoylation

    • Identify compounds that modulate pathways downstream of ZDHHC24 substrates

    • Consider combination approaches targeting multiple palmitoylation-dependent processes

  • Biomarker development:

    • Evaluate ZDHHC24 expression or activity as diagnostic/prognostic markers

    • Monitor substrate palmitoylation status as indicators of disease progression

    • Use chemical probes to assess ZDHHC24 activity in patient samples

Research on other ZDHHC family members has demonstrated their prognostic significance in diseases such as kidney renal clear cell carcinoma , suggesting that ZDHHC24 could similarly serve as a biomarker or therapeutic target in specific disease contexts.

What challenges exist in developing selective inhibitors of ZDHHC24?

Developing selective inhibitors for ZDHHC24 presents several technical challenges that researchers must address:

  • Selectivity challenges:

    • High sequence conservation in catalytic domains across ZDHHC family

    • Potential for off-target effects on other ZDHHCs or thioesterases

    • Need for extensive selectivity profiling across the ZDHHC family

  • Assay limitations:

    • Difficulty in developing high-throughput assays for membrane proteins

    • Challenge of distinguishing direct inhibition from indirect effects

    • Need for appropriate substrate selection for screening assays

  • Chemical challenges:

    • Designing inhibitors that interact with the hydrophobic acyl-binding pocket

    • Balancing potency with cellular permeability

    • Addressing potential reactivity with catalytic cysteines

  • Validation requirements:

    • Confirming on-target engagement in cellular contexts

    • Demonstrating functional consequences on substrate palmitoylation

    • Assessing compensatory upregulation of other ZDHHC enzymes

  • Structural considerations:

    • Limited structural information specifically for ZDHHC24

    • Need for reliable homology models based on related ZDHHC structures

    • Understanding substrate binding determinants for selective targeting

Overcoming these challenges requires integrated approaches combining structural biology, medicinal chemistry, chemical biology, and cellular pharmacology. The chemical-genetic strategies developed for mapping ZDHHC substrates could potentially be adapted to assess inhibitor selectivity profiles across the ZDHHC family.

What are the most pressing knowledge gaps in our understanding of ZDHHC24?

Despite progress in understanding the ZDHHC family broadly, several critical knowledge gaps remain specific to ZDHHC24:

  • Substrate specificity:

    • Comprehensive identification of physiological ZDHHC24 substrates

    • Understanding structural determinants of substrate recognition

    • Identification of unique versus redundant substrates shared with other ZDHHCs

  • Physiological roles:

    • Tissue-specific functions and expression patterns

    • Developmental roles and temporal regulation

    • Contributions to normal cellular processes

  • Disease relevance:

    • Association with specific pathologies

    • Prognostic/diagnostic significance

    • Potential as a therapeutic target

  • Regulation:

    • Mechanisms controlling ZDHHC24 expression and activity

    • Post-translational modifications affecting function

    • Response to cellular signaling events

  • Structure-function relationships:

    • Detailed structural characterization

    • Catalytic mechanism specifics

    • Membrane topology and organization

Addressing these gaps requires coordinated efforts applying complementary approaches from structural biology, biochemistry, cell biology, and systems biology. The chemical-genetic systems developed for other ZDHHC enzymes provide a promising framework for advancing our understanding of ZDHHC24 specifically.

How might emerging technologies advance ZDHHC24 research in the next decade?

Several emerging technologies hold particular promise for advancing ZDHHC24 research:

  • Advanced structural biology:

    • Cryo-EM structures of ZDHHC24 alone and in complex with substrates

    • Integration with computational approaches for dynamic modeling

    • Hydrogen-deuterium exchange mass spectrometry for conformational insights

  • Proteomics innovations:

    • Improved chemical probes for palmitoylation site identification

    • Quantitative proteomics for dynamic palmitoylation profiling

    • Spatial proteomics to map palmitoylation events to specific cellular compartments

  • Single-cell technologies:

    • Single-cell transcriptomics to capture cell-specific expression patterns

    • Spatial transcriptomics to map expression in complex tissues

    • Single-cell proteomics to assess protein-level variations

  • Advanced genome editing:

    • Base editing and prime editing for precise modification of catalytic residues

    • Multiplexed CRISPR screens to identify genetic interactions

    • In vivo editing approaches for physiological studies

  • Artificial intelligence applications:

    • Machine learning for substrate prediction

    • Deep learning for structure prediction and drug design

    • AI-assisted experimental design optimization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.