Recombinant Human Probable palmitoyltransferase ZDHHC8 (ZDHHC8)

Shipped with Ice Packs
In Stock

Description

Introduction to ZDHHC8

ZDHHC8 belongs to the family of palmitoyltransferases that catalyze S-palmitoylation, a reversible post-translational modification that involves the addition of palmitate, a 16-carbon fatty acid, to specific cysteine residues in target proteins. This enzyme is also known as Zinc finger DHHC domain-containing protein 8 (DHHC-8) or Zinc finger protein 378 . The human ZDHHC8, identified with UniProt accession number Q9ULC8, is an integral membrane protein primarily expressed in the brain and plays crucial roles in diverse cellular functions, particularly in neuronal development and activity .

S-palmitoylation significantly influences protein localization, stability, and function, making ZDHHC8 a key regulator of various cellular processes. As a probable palmitoyltransferase, ZDHHC8 catalyzes the transfer of palmitate to specific substrate proteins, modifying their behavior and subsequently impacting downstream signaling pathways . The enzyme's dysregulation has been implicated in several pathological conditions, particularly neurological disorders and cancer, highlighting its potential as a therapeutic target.

Protein Structure and Domain Organization

The ZDHHC family of proteins, including ZDHHC8, are integral membrane proteins characterized by multiple transmembrane domains (TMDs) and a distinctive DHHC-cysteine-rich domain (DHHC-CRD). While most zDHHC proteins contain four TMDs, variations exist among family members . The core structural features of ZDHHC8 include:

  1. Four transmembrane domains arranged in a tepee-like formation

  2. A cytoplasmic DHHC-CRD located between the second and third TMDs

  3. N- and C-termini positioned on the cytoplasmic face of the membrane

  4. Additional conserved motifs: DPG (Asp-Pro-Gly), TTxE (Thr-Thr-Xxx-Glu), and PaCCT (palmitoyltransferase conserved C-terminal)

The DHHC-CRD contains the canonical Asp-His-His-Cys tetrapeptide motif embedded within a larger 51-amino acid cysteine-rich domain. This region is critical for the catalytic activity of the enzyme, particularly the palmitoylation reaction .

Recombinant ZDHHC8 Properties

Commercial recombinant human ZDHHC8 protein is available in various forms for research applications. The physical and biochemical properties of typical recombinant ZDHHC8 preparations include:

PropertySpecificationNotes
Purity>85% (SDS-PAGE)Varies by manufacturer
SourceTypically yeast expression systemsEnsures proper post-translational modifications
Storage Stability6 months (liquid form at -20°C/-80°C)Depends on formulation
Storage Stability12 months (lyophilized form at -20°C/-80°C)Preferred for long-term storage
Reconstitution0.1-1.0 mg/mL in deionized waterOften with 5-50% glycerol for stability
Tag InformationVaries by manufacturerTag type determined during manufacturing
Product FormatAvailable as partial or full-length proteinApplication-dependent selection

Recombinant ZDHHC8 is typically produced in yeast expression systems to ensure proper folding and post-translational modifications. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain enzymatic activity .

Palmitoylation Mechanism

The catalytic mechanism of ZDHHC8, like other zDHHC enzymes, follows a two-step process:

  1. Autopalmitoylation: A rapid transfer of palmitate from palmitoyl-CoA to the catalytic cysteine residue within the DHHC motif, forming a palmitoyl-enzyme intermediate

  2. Transpalmitoylation: A slower transfer of the palmitate moiety from the enzyme to a cysteine residue in the substrate protein

The acyl chain of palmitoyl-CoA inserts into the tepee-like cavity formed by the four transmembrane domains. The positioning of the active site at the membrane-cytosol interface facilitates the palmitoylation of substrate proteins, particularly those with cysteines proximal to membrane regions .

Substrate Specificity

ZDHHC8 exhibits specificity for several substrate proteins involved in neuronal development and function. Research has identified numerous ZDHHC8 substrates, including:

Substrate ProteinFunctional CategoryObserved Effect of ZDHHC8 Deficiency
GRIP1Synaptic scaffold protein26% reduction in palmitoylation
GAP43Growth-associated protein17% reduction in palmitoylation
Cdc42Rho GTPase33% reduction in palmitoylation
Rac1Rho GTPase38% reduction in palmitoylation
GPX4Antioxidant enzymeReduced palmitoylation at Cys75

ZDHHC8 deficiency significantly impacts the palmitoylation status of these proteins, consequently affecting their function and localization. In Zdhhc8-deficient mice, reduced palmitoylation of these substrates leads to altered axonal growth and branching, with measurable decreases in total axon length and branch points .

Neuronal Development and Connectivity

ZDHHC8 plays a critical role in neuronal development, particularly in axonal growth and branching. Studies with Zdhhc8-deficient mice have demonstrated:

  1. Significant reduction in axon length (27.5% decrease compared to wild-type)

  2. Decreased number of axonal branch points (37.7% reduction)

  3. Altered neuronal morphology and connectivity

These effects are directly attributed to ZDHHC8's enzymatic activity, as expressing the full-length enzymatically active form (ZDHHC8-FL) in deficient neurons restores normal axonal growth and branching, while an enzymatically inactive form (ZDHHC8-C134A) fails to rescue these parameters .

Synaptic Transmission Regulation

ZDHHC8 significantly modulates excitatory glutamatergic synaptic neurotransmission, particularly through its effect on AMPA receptor-related processes. It facilitates GluA1 trafficking to the neuronal surface in the hippocampus, affecting the inward rectification of AMPA currents . This modulation of excitatory, but not inhibitory, neurotransmission contributes to ZDHHC8's role in regulating neuronal excitability and network synchrony.

Role in Ferroptosis and Cancer Immunity

A breakthrough study published in March 2025 revealed that ZDHHC8 palmitoylates glutathione peroxidase 4 (GPX4) at Cys75, a process that critically regulates ferroptosis sensitivity. GPX4 is a pivotal enzyme that mitigates lipid peroxidation, and its palmitoylation status affects its stability and function .

ZDHHC8 expression is elevated in multiple tumor types, where it may contribute to tumor cell resistance to ferroptosis. Inhibition of ZDHHC8 attenuates GPX4 palmitoylation, enhancing ferroptosis sensitivity and potentially improving cancer immunotherapy efficacy by facilitating CD8+ cytotoxic T cell-induced ferroptosis of tumor cells .

Epilepsy and Seizure Susceptibility

ZDHHC8 expression is significantly elevated in the brains of temporal lobe epilepsy (TLE) patients, mirroring observations in chronic epileptic mouse models. This correlation suggests a potential role for ZDHHC8 in epileptogenesis and seizure susceptibility .

Studies manipulating ZDHHC8 levels in experimental epilepsy models have demonstrated:

ZDHHC8 ManipulationEffect on SeizuresElectrophysiological Impact
KnockdownDelayed seizure precipitationReduced epileptiform-like discharges
KnockdownDecreased chronic spontaneous recurrent seizuresReduced neuronal hyperexcitability
OverexpressionAccelerated seizure onsetIncreased neuronal hyperexcitability
OverexpressionIncreased seizure frequencyEnhanced hypersynchrony

These findings suggest that ZDHHC8 promotes the generation and propagation of seizures, making it a potential therapeutic target for epilepsy treatment. Mechanistically, this appears to involve ZDHHC8's modulation of AMPA receptor-related excitatory glutamatergic synaptic neurotransmission .

Cancer and Ferroptosis Regulation

ZDHHC8's role in palmitoylating GPX4, a key regulator of ferroptosis, has significant implications for cancer therapy. The zDHHC8-GPX4 axis represents a novel target for anticancer strategies, particularly in combination with immunotherapy .

The identification of PF-670462 as a zDHHC8-specific inhibitor presents a promising therapeutic approach. This small molecule promotes the degradation of zDHHC8, attenuates GPX4 palmitoylation, and enhances ferroptosis sensitivity. In a B16-F10 xenograft model, PF-670462 facilitated CD8+ cytotoxic T cell-induced ferroptosis of tumor cells, improving the efficacy of cancer immunotherapy .

Therapeutic Potential and Drug Development

The identification of ZDHHC8 as a regulator of key pathological processes presents several therapeutic opportunities:

  1. Epilepsy treatment: ZDHHC8 inhibitors may reduce seizure susceptibility and frequency by modulating excitatory neurotransmission

  2. Cancer immunotherapy enhancement: Targeting the ZDHHC8-GPX4 axis may improve the efficacy of existing immunotherapies

  3. Ferroptosis modulation: ZDHHC8 inhibitors like PF-670462 offer a novel approach to inducing ferroptosis in cancer cells

PF-670462 represents the first identified ZDHHC8-specific inhibitor with demonstrated efficacy in preclinical cancer models. This compound promotes ZDHHC8 degradation, attenuates GPX4 palmitoylation, and enhances tumor cell susceptibility to ferroptosis, thereby improving the efficacy of cancer immunotherapy .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ZDHHC8; KIAA1292; ZDHHCL1; ZNF378; Palmitoyltransferase ZDHHC8; Zinc finger DHHC domain-containing protein 8; DHHC-8; Zinc finger protein 378
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-765
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZDHHC8
Target Protein Sequence
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGA AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCCGNV EHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAPLKVKLSDNGLKAGLGRSKSK GSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPA FPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYD SLLNPGSPGGHACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVR YDNLSRTIMASIQERKDREERERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGP ALRYGSRDDLVAGPGFGGARNPALQTSLSSLSSSVSRAPRTSSSSLQADQASSNAPGPRP SSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPEPPPSLTVQRDHPQLKTPPSK LNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
ZDHHC8 is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates, playing a role in several diverse biological processes. By palmitoylating ABCA1, ZDHHC8 regulates the localization of this transporter to the plasma membrane, thereby influencing its function in cholesterol and phospholipid efflux. ZDHHC8 can also palmitoylate the D(2) dopamine receptor (DRD2), impacting its stability and localization to the plasma membrane. Additionally, ZDHHC8 may contribute to glutamatergic transmission.
Gene References Into Functions
  1. A case-control study involving a population from the North Region of Brazil investigated the association between the COMT Val158Met and ZDHHC8 rs175174 single nucleotide polymorphism and the susceptibility to schizophrenia. PMID: 28562378
  2. Research suggests that ZDHHC8 may play a role in cortical volumes in patients with schizophrenia. PMID: 23403413
  3. Increased corpus callosum volume in children with 22q11DS is associated with ZDHHC8 polymorphism. PMID: 22763378
  4. Consistently negative associations with schizophrenia were found in the rs175174 polymorphism. PMID: 20661937
  5. This study provides the first evidence that ZDHHC8 polymorphisms on the 22q11 locus are associated with smooth pursuit eye movement (SPEM) abnormality in a Korean population. PMID: 20468065
  6. Three genetic variants within the ZDHHC8 locus were genotyped and association studies were conducted in both population- and family-based samples of the Han Chinese population. PMID: 15489219
  7. Due to the large sample size, ZDHHC8 may not play a major role in Japanese schizophrenia. Our results did not support a gender-specific effect of this SNP. PMID: 15631889
  8. Single nucleotide polymorphism is not associated with chromosome 22 deletion or schizophrenia. PMID: 17728672

Show More

Hide All

Database Links

HGNC: 18474

OMIM: 608784

KEGG: hsa:29801

STRING: 9606.ENSP00000384716

UniGene: Hs.63128

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is ZDHHC8 and what are its structural characteristics?

ZDHHC8 (Zinc finger DHHC-type containing 8) is a palmitoyltransferase enzyme that catalyzes the addition of palmitate to specific protein substrates through S-palmitoylation. It is encoded by the ZDHHC8 gene located on chromosome 22 with Entrez Gene ID 29801 . The protein has a molecular weight of approximately 30.36 kDa . ZDHHC8 contains a characteristic DHHC domain that is critical for its catalytic activity. This domain is a cysteine-rich region that coordinates zinc ions and contains the DHHC (Asp-His-His-Cys) amino acid motif that gives this enzyme family its name.

For experimental validation of ZDHHC8's catalytic activity, researchers typically generate transferase-dead mutants (referred to as ZDHHS8) by replacing the critical cysteine residue in the DHHC motif with serine . This mutation abolishes palmitoyltransferase activity while maintaining protein structure, serving as an excellent negative control in palmitoylation assays.

How should recombinant ZDHHC8 protein be stored and handled in experimental settings?

Recombinant ZDHHC8 requires specific storage conditions to maintain structural integrity and enzymatic activity. Commercial recombinant human ZDHHC8 protein should be stored at -80°C and researchers should avoid repeated freeze-thaw cycles to prevent protein degradation and loss of activity .

The recombinant protein is typically supplied in a buffer containing 50 mM Tris-HCl and 10 mM reduced glutathione at pH 8.0 . This formulation helps maintain protein stability and solubility. When working with ZDHHC8:

  • Always use fresh aliquots for critical experiments

  • Keep the protein on ice when thawed

  • Use protein purity verification methods (such as SDS-PAGE) before experimental applications

  • Consider including protease inhibitors when working with the enzyme for extended periods

What experimental approaches can be used to study ZDHHC8-mediated protein palmitoylation?

Several methodological approaches are available for investigating ZDHHC8-mediated palmitoylation:

Acyl-Biotin Exchange (ABE) Assay: This technique identifies palmitoylated proteins by replacing thioester-linked palmitate with biotin. In experimental settings, Gp130 palmitoylation has been detected using ABE, with specificity confirmed by absence of signal when hydroxylamine (a key reagent) is omitted or when cells are treated with the palmitoylation inhibitor 2-bromopalmitate (2BP) .

Co-expression Studies: To determine if a protein is a direct substrate of ZDHHC8, researchers co-express the candidate substrate with wild-type or catalytically inactive ZDHHC8 in cell lines such as HEK293T. Significantly increased palmitoylation of a protein by wild-type ZDHHC8 but not by the transferase-dead mutant (ZDHHS8) indicates direct palmitoylation by ZDHHC8 .

Gene Knockdown Approaches: ShRNA-mediated knockdown of ZDHHC8 in neurons or other cell types allows researchers to assess the impact on substrate palmitoylation and downstream functions. For instance, Zdhhc5/8 knockdown reduced Gp130 palmitoylation in DRG neurons .

Surface Expression Analysis: Since palmitoylation often affects protein trafficking, surface biotinylation assays can be used to quantify changes in plasma membrane localization of ZDHHC8 substrates following manipulation of ZDHHC8 expression or activity .

What are the known substrates of ZDHHC8 and how are they identified?

ZDHHC8 has been shown to palmitoylate several important proteins in various cellular contexts:

SubstrateExperimental EvidenceFunctional Impact of PalmitoylationReference
Gp130Enhanced palmitoylation when co-expressed with WT ZDHHC8 but not with ZDHHS8 mutantRegulates surface expression and signaling capability
ScribbleIdentified in Drosophila studiesAffects tissue growth regulation
Ras64BIdentified in Drosophila studiesInfluences cancer-related processes
GluA1 (AMPA receptor)Altered trafficking upon ZDHHC8 knockdownAffects synaptic localization and glutamatergic neurotransmission

To identify novel ZDHHC8 substrates, researchers typically employ:

  • Palmitoyl-proteomics: Mass spectrometry-based approaches to identify proteins with reduced palmitoylation following ZDHHC8 knockdown or knockout

  • Candidate approach: Testing specific proteins based on phenotypic similarities with ZDHHC8-deficient models

  • Proximity labeling: Using BioID or APEX2 fused to ZDHHC8 to identify proteins in close proximity that may be substrates

What is the role of ZDHHC8 in epilepsy and seizure susceptibility?

ZDHHC8 has emerged as a critical regulator of neuronal excitability and seizure susceptibility. Studies show increased ZDHHC8 expression in temporal lobe epilepsy (TLE) patients and chronic epileptic mouse models, establishing a strong correlation between ZDHHC8 levels and human epilepsy .

Experimental evidence from in vivo models:

  • Knockdown of ZDHHC8 using recombinant adeno-associated virus (rAAV) significantly delayed seizure precipitation in kainic acid- and pilocarpine-induced epileptic mouse models

  • ZDHHC8 knockdown reduced chronic spontaneous recurrent seizures (SRSs) and epileptiform-like discharges

  • Conversely, ZDHHC8 overexpression accelerated seizure onset and increased seizure severity

Cellular mechanisms:
ZDHHC8 exerts its effects primarily through modulation of AMPA receptor-mediated excitatory glutamatergic neurotransmission. Electrophysiological studies in acute hippocampal slices revealed that ZDHHC8 significantly affects the inward rectification of AMPA currents . Mechanistically, ZDHHC8 facilitates GluA1 trafficking to the neuronal surface in the hippocampus, thereby enhancing excitatory synaptic transmission.

Methodological approaches for studying ZDHHC8 in epilepsy:

  • Viral-mediated gene manipulation: Using rAAV to knockdown or overexpress ZDHHC8 in specific brain regions

  • Electrophysiological recordings: Whole-cell patch-clamp recordings in acute brain slices to measure AMPA receptor-mediated currents

  • In vitro seizure models: Magnesium-free models to induce neuronal hyperexcitability and assess the impact of ZDHHC8 manipulation

How does ZDHHC8 contribute to axonal growth and neuronal connectivity in development and disease?

ZDHHC8 plays a crucial role in axonal development, particularly in the context of 22q11.2 deletion syndrome, which is associated with cognitive deficits and schizophrenia risk .

Developmental effects:

  • ZDHHC8-deficient mice exhibit deficits in axonal growth during embryogenesis

  • Mutant neurons show impaired terminal arborization, which can be prevented by reintroduction of enzymatically active ZDHHC8

  • ZDHHC8 deficiency reduces the proportion of neurons developing a single axon (62.1±1.8% in Zdhhc8-/- vs. 77.0±0.9% in wild-type neurons)

  • Axon length is significantly reduced in ZDHHC8-deficient neurons (305.2±22.2 μm in Zdhhc8-/- vs. 421.4±17.1 μm in wild-type neurons)

Molecular mechanism:
ZDHHC8 mediates its effects on axonal growth via Cdc42-dependent modulation of Akt/Gsk3β signaling at the axon tip. Pharmacological reduction of Gsk3β activity during postnatal brain development can reverse the axonal growth deficits in ZDHHC8-deficient models .

Functional consequences:

  • Impaired terminal arborization of pyramidal neurons due to ZDHHC8 deficiency leads to reduced strength of synaptic connections

  • This results in altered functional connectivity and spatial working memory deficits

  • These structural connectivity changes may represent predisposing factors for psychiatric symptoms associated with 22q11.2 deletion

Experimental approaches:

  • Neuronal culture analysis: Dissociated cortical neurons cultured and analyzed for axon polarity using Tau-1 (axon marker) and MAP2 (dendritic marker) antibodies

  • Genetic rescue experiments: Reintroduction of wild-type or mutant ZDHHC8 to assess rescue of axonal phenotypes

  • Pharmacological intervention: Using Gsk3β inhibitors to assess rescue of axonal growth deficits

What is the relationship between ZDHHC8 expression and cancer outcomes?

ZDHHC8 exhibits complex associations with cancer prognosis that vary by cancer type, suggesting context-dependent functions in oncogenesis .

Cancer correlation data:

  • High expression of ZDHHC8 correlates with shorter survival times in renal and cervical cancers

  • Conversely, high ZDHHC8 expression correlates with longer survival rates in lung and pancreatic cancers

Functional evidence from model organisms:
Studies in Drosophila show that ZDHHC8 knockdown causes tissue overgrowth, suggesting a potential tumor suppressor role in some contexts . The mechanism appears to involve palmitoylation of key growth regulators such as Scribble and Ras64B.

Research methodologies:

  • Survival correlation analysis: Mining cancer databases to correlate ZDHHC8 expression with patient outcomes across different cancer types

  • Genetic manipulation in model organisms: Using knockdown or overexpression approaches to assess effects on tissue growth

  • Substrate identification: Identifying cancer-relevant palmitoylation targets of ZDHHC8 that may explain its context-dependent effects

How do ZDHHC5 and ZDHHC8 cooperatively regulate Gp130 palmitoylation and surface expression?

ZDHHC5 and ZDHHC8 exhibit unique properties in regulating Gp130, a critical cytokine receptor signaling component, through palmitoylation .

Experimental findings:

  • Both ZDHHC5 and ZDHHC8 can directly palmitoylate Gp130 when co-expressed in HEK293T cells

  • Wild-type forms of both enzymes significantly increase Gp130 palmitoylation, while their transferase-dead mutants (ZDHHS5 and ZDHHS8) do not

  • In DRG neurons, combined Zdhhc5/8 knockdown more effectively reduces Gp130 palmitoylation than single knockdowns

  • ZDHHC8 knockdown more markedly reduces Gp130 surface localization than ZDHHC5 knockdown

Mechanistic insights:

  • ZDHHC5 and ZDHHC8 are likely localized to the axonal plasma membrane, explaining their effect on Gp130 surface expression

  • Combined Zdhhc5/8 knockdown only partially reduces Gp130 palmitoylation, suggesting other PATs may palmitoylate Gp130 at different cellular locations

  • Different palmitoylation sites on Gp130 may be targeted by different PATs, with ZDHHC5/8 potentially palmitoylating sites more critical for surface expression and signaling

Methodological approaches:

  • Acyl-Biotin Exchange (ABE): To measure Gp130 palmitoylation levels

  • Surface biotinylation assays: To quantify surface expression of Gp130

  • Combined genetic approaches: Using single and double knockdowns to assess cooperative functions

What considerations are important when using recombinant ZDHHC8 protein in functional studies?

When using recombinant ZDHHC8 for functional studies, several important considerations should be addressed:

Specific applications:
Recombinant ZDHHC8 protein has been validated for several applications:

  • Western Blot

  • ELISA

  • Protein Array

  • Immunoaffinity Purification

Purity considerations:
Commercial preparations typically have >80% purity as assessed by SDS-PAGE and Coomassie blue staining . For applications requiring higher purity, additional purification steps may be necessary.

Activity assessment:
To verify enzymatic activity of recombinant ZDHHC8:

  • Perform in vitro palmitoylation assays using purified substrate proteins

  • Include positive controls (known ZDHHC8 substrates like Gp130)

  • Include negative controls (non-substrate proteins or reactions with catalytically inactive ZDHHC8)

  • Verify palmitate incorporation using either radiolabeled palmitate or ABE methodology

What strategies can be employed to modulate ZDHHC8 activity for potential therapeutic applications?

Given ZDHHC8's involvement in neurological disorders and cancer, modulating its activity presents potential therapeutic opportunities:

Pharmacological inhibition:

  • Broad-spectrum palmitoylation inhibitors like 2-bromopalmitate (2BP) inhibit ZDHHC8 activity but lack specificity

  • Development of selective ZDHHC8 inhibitors would require high-throughput screening approaches and structural biology insights

Genetic modulation:

  • Viral-mediated knockdown approaches using shRNA or CRISPR-Cas9 have shown efficacy in preclinical models

  • For epilepsy applications, rAAV-mediated ZDHHC8 knockdown delayed seizure precipitation and decreased chronic spontaneous recurrent seizures in mouse models

Downstream pathway modulation:

  • In neuronal development contexts, targeting downstream effectors like Gsk3β pharmacologically can reverse ZDHHC8 deficiency effects

  • ZDHHC8 deficiency impacts are mediated in part via Cdc42-dependent modulation of Akt/Gsk3β signaling

Considerations for therapeutic development:

  • Cell-type specificity: Ensure targeted delivery to appropriate cell types

  • Timing of intervention: Consider developmental windows where intervention would be most effective

  • Substrate specificity: Target specific ZDHHC8-substrate interactions rather than global ZDHHC8 activity

  • Disease context: Account for potentially opposing roles in different disease contexts

How can researchers distinguish between direct and indirect effects of ZDHHC8 manipulation in experimental systems?

Distinguishing direct from indirect effects of ZDHHC8 manipulation requires careful experimental design:

Substrate validation approaches:

  • In vitro palmitoylation assays: Demonstrate direct palmitoylation using purified components

  • Catalytic mutant controls: Compare effects of wild-type ZDHHC8 with catalytically inactive ZDHHS8 mutant

  • Site-directed mutagenesis of substrate: Mutate putative palmitoylation sites (typically cysteines) in the substrate protein and assess if this abolishes ZDHHC8-dependent effects

Controls for indirect effects:

  • Assess global palmitoylation changes: Use techniques like click chemistry or ABE coupled with proteomics to determine if ZDHHC8 manipulation causes widespread palmitoylation changes

  • Examine expression levels of other PATs: Rule out compensatory expression changes in other ZDHHC enzymes

  • Time-course experiments: Distinguish immediate (likely direct) versus delayed (possibly indirect) effects of ZDHHC8 manipulation

Rescue strategies:
When ZDHHC8 knockdown affects multiple cellular processes, determine which are due to direct palmitoylation by performing substrate-specific rescue experiments, such as expressing palmitoylation-mimetic versions of key substrates.

What are the challenges in interpreting contradictory findings regarding ZDHHC8 function across different experimental systems?

Researchers face several challenges when interpreting seemingly contradictory findings about ZDHHC8:

Context-dependent functions:
ZDHHC8 shows opposing associations with survival across different cancer types , suggesting its function depends on cellular context. Similarly, its neuronal functions may vary by brain region, developmental stage, or disease state.

Technical considerations:

  • Knockout versus knockdown: Complete knockout may trigger compensatory mechanisms not seen with partial knockdown

  • Acute versus chronic manipulation: Transient versus stable loss of ZDHHC8 may produce different phenotypes

  • In vitro versus in vivo systems: Cell culture findings may not translate to intact organisms

Substrate availability:
ZDHHC8 function depends on substrate availability, which varies across tissues and cell types. For example, Gp130 palmitoylation by ZDHHC8 may be more significant in neurons than in other cell types where Gp130 expression is lower or where other PATs predominate.

Methodological approaches to address contradictions:

  • Side-by-side comparison of models: Direct comparison using identical methodologies

  • Conditional/inducible systems: Use of temporal and spatial control of ZDHHC8 manipulation

  • Multi-omics approaches: Integration of transcriptomics, proteomics, and palmitoyl-proteomics data to build comprehensive models of ZDHHC8 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.