Recombinant Human Probable polyprenol reductase (SRD5A3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Glycosylation

SRD5A3 catalyzes two critical biochemical reactions:

  1. Polyprenol → Dolichol: Converts polyprenol to dolichol via NADPH-dependent reduction of the α-isoprene unit, enabling dolichol phosphate synthesis .

  2. Testosterone → DHT: Secondary steroid 5α-reductase activity, though less prominent than its role in glycosylation .

Dolichol phosphate serves as the scaffold for assembling lipid-linked oligosaccharides (LLOs), which are transferred to proteins during N-glycosylation. SRD5A3 deficiency disrupts this process, leading to congenital disorders of glycosylation (CDGs) .

Association with Human Disorders

Mutations in SRD5A3 cause SRD5A3-CDG (CDG-Iq), characterized by:

  • Neurological deficits (e.g., intellectual disability, cerebellar atrophy)

  • Ophthalmological abnormalities (e.g., cataracts, coloboma)

  • Skeletal malformations (e.g., kyphosis)

Metabolic Hallmarks in SRD5A3-CDG:

  • ↑ Polyprenol (30–70-fold in knockout cells)

  • ↓ Dolichol (5–6-fold reduction)

  • Accumulation of polyprenal and polyprenoic acid (in SRD5A3-KO only)

A. Dolichol Biosynthesis Pathway Revisions

Recent studies propose SRD5A3 collaborates with DHRSX:

  1. DHRSX oxidizes polyprenol to polyprenal.

  2. SRD5A3 reduces polyprenal to dolichal, which is further processed to dolichol .
    This challenges the prior assumption that SRD5A3 directly reduces polyprenol.

B. Animal Models

  • Arabidopsis: PPRD2 (SRD5A3 ortholog) knockout causes lethality due to impaired protein glycosylation .

  • Mice: Cerebellum-specific Srd5a3 deletion disrupts granule cell development, highlighting its role in neurodevelopment .

C. Therapeutic Insights

  • Yeast complementation assays confirm SRD5A3’s functional orthology to DFG10, enabling mechanistic studies .

  • Proteomic analyses identify hypoglycosylated proteins (e.g., LAMP2) as biomarkers for SRD5A3 dysfunction .

Future Directions

  • Resolve SRD5A3’s 3D structure to guide drug design for CDG-Iq.

  • Investigate tissue-specific redundancy in dolichol synthesis pathways .

  • Develop small-molecule activators to bypass SRD5A3 deficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SRD5A3; SRD5A2L; Polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Steroid 5-alpha-reductase 2-like; Steroid 5-alpha-reductase 3; S5AR 3; SR type 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SRD5A3
Target Protein Sequence
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK SKFVSYPKHRKAFLPFLF
Uniprot No.

Target Background

Function
Probable polyprenol reductase (SRD5A3) plays a crucial role in the early stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor utilized in N-glycosylation. SRD5A3 acts as a polyprenol reductase, facilitating the reduction of the alpha-isoprene unit of polyprenols into dolichols through an NADP-dependent mechanism. Additionally, it possesses the capability to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Gene References Into Functions
  1. This study provides the first evidence of 5alpha-reductase-R3 mRNA in human hair. PMID: 29185104
  2. These findings suggest that 5alpha-reductases (5-AR) isoenzymes could be a therapeutic target for urothelial bladder cancer (UBC) with 5alpha-reductase inhibitors (5-ARI). PMID: 29187470
  3. We present the characteristics of five individuals (three children and two adults) with mutations in SRD5A3, highlighting the variability in eye and skin involvement. PMID: 27480077
  4. Although 4-dione is the primary source of 5alpha-dihydrotestosterone in human preadipocytes, the production of this steroid by 5 alpha-reductase isoenzymes (SRD5A1, 2, and 3) mediates the inhibitory effect of both 4-dione and testosterone on preadipocyte differentiation. PMID: 26855069
  5. Mutations in the SRD5A3 gene can cause early-onset retinal dystrophy, a previously underreported feature of the SRD5A3-CDG disorder that is progressive and can lead to severe visual impairment. PMID: 28253385
  6. This research examines the spectrum of phenotypes resulting from SRD5A3 mutations and the clinical variability of SRD5A3-CDG. PMID: 24433453
  7. The findings suggest that overexpression of 5alpha-reductase, through enhanced inactivation of cortisol in the liver, could have a protective role in maintaining hepatic insulin sensitivity. PMID: 21704348
  8. Next-generation sequencing identified a homozygous frameshift mutation (c.203dupC; p.Phe69LeufsX2) in SRD5A3 as the disease-causing change in Kahrizi syndrome. PMID: 20700148
  9. A novel syndrome is identified in families with cerebellar ataxia and congenital eye malformations due to steroid 5 alpha-reductase type 3 disorders of glycosylation. PMID: 20852264
  10. A study of a large consanguineous Emirati family revealed that loss-of-function mutations in the SRD5A3 gene cause a multisystemic syndrome characterized by eye malformations, cerebellar vermis hypoplasia, and psychomotor delay. PMID: 20637498
  11. This research indicates that a novel type 3 5 alpha-steroid reductase, SRD5A3, is associated with DHT production and the maintenance of androgen-androgen receptor pathway activation in prostate cancer. PMID: 17986282

Show More

Hide All

Database Links

HGNC: 25812

OMIM: 611715

KEGG: hsa:79644

STRING: 9606.ENSP00000264228

UniGene: Hs.39311

Involvement In Disease
Congenital disorder of glycosylation 1Q (CDG1Q); Kahrizi syndrome (KHRZ)
Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in preadipocytes (at protein level). Overexpressed in hormone-refractory prostate cancers (HRPC). Almost no or little expression in normal adult organs.

Q&A

What is the primary function of SRD5A3 in human cells?

SRD5A3 functions as a polyprenol reductase enzyme that catalyzes the conversion of polyprenol to dolichol in the endoplasmic reticulum. This conversion is a critical step in the dolichol biosynthesis pathway, which is essential for N-linked protein glycosylation, O-mannosylation, C-mannosylation, and GPI anchor synthesis. Recent studies have revised our understanding of this pathway, showing that SRD5A3 specifically reduces polyprenal to dolichal, which is then further processed to dolichol by an unknown reductase .

How does SRD5A3 differ from other members of the steroid 5α-reductase family?

While other members of the SRD5A family (like SRD5A1 and SRD5A2) are primarily involved in steroid hormone metabolism, SRD5A3 plays a crucial role in protein glycosylation. Unlike SRD5A1 and SRD5A2, which are downregulated in certain conditions such as hepatocellular carcinoma, SRD5A3 is often overexpressed . SRD5A3 is unique among the family in its essential role in the conversion of polyprenol to dolichol, a process distinct from steroid metabolism but critical for developmental processes .

What are the metabolic changes observed in SRD5A3 deficiency?

LC-MS studies in SRD5A3-knockout cell lines reveal a 5-6 fold reduction in dolichol levels compared to wild-type cells. Additionally, polyprenol (the substrate for SRD5A3) levels increase 30-70 fold. In SRD5A3-deficient cells specifically, polyprenal and polyprenoic acid are massively increased (85-fold and 10-fold respectively), which is not observed in DHRSX-deficient cells. These metabolic changes can be rescued by re-expression of the SRD5A3 gene in knockout cells .

What are the recommended methods for studying SRD5A3 enzyme activity in vitro?

To effectively study SRD5A3 enzyme activity, researchers should employ LC-MS techniques to measure polyprenol, polyprenal, polyprenoic acid, and dolichol levels in cellular extracts. The activity can be assessed by monitoring the reduction of polyprenol to dolichol using radiolabeled substrates or by measuring the accumulation of metabolites. For instance, in HAP1 cell lines with CRISPR/Cas9-inactivated SRD5A3, a 6-fold reduction in dolichol levels and 30-fold increase in polyprenol can be detected using these methods . Rescue experiments involving re-expression of SRD5A3 should be included as controls to confirm the specificity of observed effects.

How can researchers generate and validate SRD5A3 knockout models?

Effective SRD5A3 knockout models can be generated using CRISPR/Cas9 technology targeting the SRD5A3 gene. Validation should include both genotypic confirmation through sequencing and functional validation through:

  • Measurement of dolichol and polyprenol levels using LC-MS

  • Assessment of N-glycosylation defects through mobility shift assays of glycoproteins like LAMP2

  • Complementation studies with wild-type SRD5A3 to rescue the phenotype

  • Evaluation of tissue-specific effects using conditional knockouts (as seen in cerebellum-specific SRD5A3 knockouts)

For tissue-specific studies, the Cre-lox system has been effectively employed, as demonstrated in the En1-Cre; Srd5a3fl/- mouse model for cerebellum-specific deletion .

What proteomic approaches are most effective for identifying SRD5A3-dependent glycoproteins?

To identify proteins affected by SRD5A3 deficiency, researchers should implement:

  • Total proteomic analysis using high-resolution mass spectrometry to quantify differentially abundant proteins (as demonstrated in P7 mouse cerebellum studies identifying 97 differentially abundant proteins)

  • Lectin-affinity based enrichment steps (using ConA, WGA, RCA120) at the peptide level, followed by deglycosylation and proteomic analysis to identify specific N-glycosylation sites and quantify their abundance

  • Clustering analysis of proteomics data to identify pathways affected by SRD5A3 deficiency

This approach has revealed that SRD5A3 loss preferentially affects proteins with high N-glycan multiplicity (four or more N-glycosylation sites per protein) .

ParameterResult in SRD5A3 Studies
Total proteins quantified in proteomics1982
Differentially abundant proteins97 (≈5% of total)
New glycosylation sites identified140 (≈8% of total)
Most affected proteinsThose with ≥4 N-glycosylation sites

How does the functional relationship between DHRSX and SRD5A3 revise our understanding of the dolichol biosynthesis pathway?

Recent studies have prompted a significant revision of the dolichol biosynthesis pathway. While SRD5A3 was traditionally thought to directly convert polyprenol to dolichol, new evidence suggests a more complex pathway. DHRSX appears to be required for converting polyprenol to polyprenal, after which SRD5A3 reduces the C2-C3 double bond of polyprenal to produce dolichal. This dolichal is then further reduced to dolichol by an as-yet-unidentified reductase .

This revision is supported by metabolite analysis showing that:

  • Both DHRSX and SRD5A3 deficiencies lead to reduced dolichol and increased polyprenol

  • Polyprenal and polyprenoic acid accumulate specifically in SRD5A3-deficient cells but not in DHRSX-deficient cells

  • Re-expression of either gene in the corresponding knockout cells rescues the metabolic phenotype

What is the relationship between SRD5A3 expression and tissue-specific phenotypes in SRD5A3-CDG?

The tissue-specific manifestations of SRD5A3-CDG present an intriguing research question. SRD5A3 is highly expressed in the fetal brain , which may explain the predominant neurological phenotypes. In a cerebellum-specific SRD5A3 knockout mouse model, researchers observed motor coordination defects and abnormal granule cell development . Proteomic analysis revealed that SRD5A3 loss affects a specific subset of glycoproteins, particularly those that are highly glycosylated .

The eye phenotype may be explained by the role of highly glycosylated IgSF-CAM members in both the developing eye and cerebellum . The variability in clinical presentation, including intra-familial variability , suggests the existence of genetic modifiers or environmental factors that influence the phenotypic expression of SRD5A3 mutations.

How do various SRD5A3 mutations differently impact enzymatic function and clinical phenotypes?

Different mutations in SRD5A3 show variable effects on enzymatic function and clinical presentation. For example, the frameshift mutation c.203dupC (p.Phe69LeufsX2) leads to Kahrizi syndrome, characterized by mental retardation, coloboma, cataract, and kyphosis . The novel missense variant NM_024592.5(SRD5A3):c.775G>A;p.Glu259Lys has been associated with mirror movements and dystonia in addition to the classic CDG phenotype .

Clinical research has documented significant phenotypic variability even among siblings carrying identical mutations, suggesting that:

  • Other genetic factors may modify SRD5A3 activity or compensate for its deficiency

  • Environmental factors might influence the severity of glycosylation defects

  • The timing and context of glycosylation requirements during development may affect which systems are most impacted

Future research should focus on identifying these modifiers and understanding how they interact with specific SRD5A3 mutations to produce the observed phenotypic spectrum.

What biomarkers are most reliable for diagnosing SRD5A3-CDG in research and clinical settings?

While transferrin isoelectric focusing patterns have traditionally been used to diagnose congenital disorders of glycosylation, this approach may yield false negatives in some cases of SRD5A3-CDG. In the family reported by Cantagrel et al., as well as the family reported by Al-Gazali et al., repeated CDG testing failed to detect abnormalities despite confirmed SRD5A3 mutations .

More reliable biomarkers include:

  • Direct measurement of dolichol and polyprenol levels in patient fibroblasts or lymphoblasts using LC-MS, which typically shows increased polyprenol (20-30 fold) and decreased dolichol (2-3 fold)

  • Detection of N-glycosylation defects through mobility shift assays of glycoproteins such as LAMP2

  • Genetic testing for pathogenic variants in SRD5A3, which remains the gold standard for diagnosis

Researchers should note that metabolite changes may show context-dependent behavior, with fold-changes being much lower in patient fibroblasts compared to knockout cell lines, possibly due to compensatory mechanisms .

How do SRD5A3 deficiencies affect neurological development at the cellular and molecular levels?

SRD5A3 deficiencies impact neurological development through several mechanisms:

  • Impaired glycosylation of specific proteins critical for cerebellar development, particularly those with high N-glycan multiplicity. Proteomic studies in cerebellum-specific SRD5A3 knockout mice identified impaired IgSF-CAM–mediated neurite growth and axon guidance .

  • The finding of severe frontal microgyria in some patients suggests neuronal migration defects, similar to those seen in O-mannosylation defects. Since O-mannosylation might also be hampered in SRD5A3-CDG, this could contribute to cortical malformations .

  • MRI studies have revealed cerebellar atrophy, vermis malformations, mal-rotated hippocampus, and small brainstem features in SRD5A3-CDG patients, indicating diverse impacts on brain development .

These findings highlight the importance of proper glycosylation for neuronal development, particularly in the cerebellum, and explain the high prevalence of ataxia (5/11 in one cohort) and motor coordination defects in affected individuals .

What are the emerging therapeutic approaches for SRD5A3-CDG based on current understanding of its pathophysiology?

While there are currently no approved treatments specifically for SRD5A3-CDG, several therapeutic approaches show promise based on current understanding of SRD5A3 function:

  • Dietary supplementation: Since SRD5A3-CDG is a single-gene disorder affecting a metabolic pathway, specialized dietary supplementation might bypass or compensate for the enzymatic defect .

  • Gene therapy approaches: As SRD5A3-CDG is caused by mutations in a single gene, it represents a promising candidate for gene therapy, potentially through viral vector-mediated gene delivery to affected tissues .

  • Targeted small molecules: Compounds that could enhance residual SRD5A3 activity or provide alternative routes for dolichol synthesis might be therapeutic.

  • Substrate reduction therapy: Approaches aimed at reducing the toxic accumulation of polyprenols that compete with dolichols during glycosylation might ameliorate symptoms .

Research organizations like Cure SRD5A3 are working to bring together researchers, families, and resources to advance knowledge and find treatments . The development of disease-specific registries will help capture manifestations of this ultrarare CDG subtype and guide future therapeutic approaches .

Beyond glycosylation, what other cellular processes might SRD5A3 influence?

While SRD5A3's role in glycosylation is well-established, evidence suggests it may influence other cellular processes:

  • Androgen receptor signaling pathway: In hepatocellular carcinoma, SRD5A3 overexpression appears to influence steroid hormone biosynthesis, lipid biosynthetic processes, and androgen metabolic processes .

  • Cellular toxicity management: The balance between polyprenols and dolichols may affect cellular health beyond glycosylation. In Arabidopsis, the considerable difference in chain length between polyprenols and dolichols suggests substrate specificity mechanisms that protect cells against potential toxicity of polyprenol excess .

  • Other reduction reactions: The involvement of SRD5A3 in other pathways besides the dolichol cycle, including the reduction of other vital cellular substrates, cannot be ruled out .

Future research should explore these potential alternative functions and how they might contribute to the complex phenotypes observed in SRD5A3-CDG.

How do compensatory mechanisms operate in SRD5A3 deficiency across different tissues?

Research has shown significant variability in how different tissues respond to SRD5A3 deficiency, suggesting the existence of compensatory mechanisms:

  • In patient fibroblasts, metabolite changes show the same trends as in knockout cell lines but with much lower fold-changes, suggesting adaptive responses .

  • The context-dependent behavior of SRD5A3 deficiency resembles what has been described in SRD5A3-CDG patient cells and might be due to compensatory changes .

  • The intra-familial variability in clinical symptoms among siblings with identical mutations points to variable compensation across individuals .

Understanding these compensatory mechanisms could provide important insights for therapeutic development. Research should focus on identifying the molecular pathways that enable some cells to maintain adequate glycosylation despite SRD5A3 deficiency.

What is the evolutionary significance of the SRD5A3 enzyme across species?

The SRD5A3 enzyme has orthologs across diverse species, suggesting important conserved functions:

  • In Arabidopsis thaliana, two genes encoding polyprenol reductase (PPRD-1 and -2) are orthologs of SRD5A3 and DFG10. The PPRD2 knockout mutation is lethal due to male sterility, indicating essential roles in plant development .

  • Unlike human SRD5A3 mutations, which don't include impaired fertility in their clinical manifestations, plant PPRD2 is essential for gametophyte development .

  • The substrate specificity of enzymes in the dolichol pathway appears to differ across species, with Arabidopsis leaves containing polyprenols (Pren-10 dominating) that highly exceed dolichols (Dol-16 dominating) .

This evolutionary comparison provides insights into both conserved and divergent functions of SRD5A3-like enzymes across kingdoms and may help identify novel roles or therapeutic approaches for human SRD5A3-related disorders.

What technological advances might enhance our ability to study SRD5A3 function and related disorders?

Several technological advances could significantly enhance SRD5A3 research:

  • Single-cell glycomics and proteomics to understand cell-specific effects of SRD5A3 deficiency

  • Advanced imaging techniques to visualize the subcellular localization and dynamics of SRD5A3 and its substrates

  • CRISPR-based screening approaches to identify genetic modifiers of SRD5A3 function

  • Patient-derived organoids to model tissue-specific effects of SRD5A3 mutations

  • Improved metabolomics methods for detailed analysis of dolichol pathway intermediates in small samples

These technologies would allow researchers to address key questions about the tissue-specific effects of SRD5A3 deficiency and potentially identify novel therapeutic targets.

How can systems biology approaches integrate glycosylation pathways with other cellular processes affected by SRD5A3?

Systems biology approaches could provide a more comprehensive understanding of SRD5A3 function by:

  • Integrating multi-omics data (genomics, transcriptomics, proteomics, glycomics, metabolomics) from models of SRD5A3 deficiency

  • Computational modeling of dolichol synthesis pathways and their interaction with other cellular processes

  • Network analysis to identify hub proteins and pathways affected by SRD5A3 deficiency

  • Machine learning approaches to predict phenotypic outcomes based on specific SRD5A3 mutations and genetic background

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.