Recombinant Human Proepiregulin (EREG)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant Human Proepiregulin (EREG) is synthesized as a transmembrane glycoprotein that undergoes proteolytic cleavage to release the mature, bioactive epiregulin peptide. Key structural and production features include:

FeatureDetailsSource
Amino Acid RangeVal63-Leu108 (mature sequence)
Molecular Weight5.6–32.6 kDa (varies by expression system and glycosylation)
Expression SystemsE. coli (non-glycosylated), HEK293 (glycosylated)
TagsHis-tag (N-terminus), hFc-tag (N- or C-terminus)
Purity>90% (SDS-PAGE or HPLC)

For example:

  • E. coli-derived EREG: Non-glycosylated, 7.7 kDa with His-tag .

  • HEK293-derived EREG: Glycosylated, 32.6 kDa with hIgG-His tag .

Biological Functions and Signaling Mechanisms

EREG binds EGFR and ErbB4, activating downstream pathways such as MEK/ERK and PI3K/AKT. Its roles include:

FunctionMechanismImplications
Cell ProliferationStimulates keratinocytes, fibroblasts, and vascular smooth muscle cellsTissue repair, wound healing
AngiogenesisInduces vascular remodeling via ADAM-mediated sheddingCancer progression
Oncogenic ActivitySustains EGFR signaling, promotes epithelial–mesenchymal transition (EMT)Lung, colon, and bladder cancers
Anti-Tumor EffectsInhibits growth of specific epithelial tumor cell linesTherapeutic potential

Notably, EREG stabilizes weaker EGFR dimers compared to EGF, leading to prolonged ERK activation and differentiation over proliferation .

In Vitro and Preclinical Studies

  • Cancer Research: EREG overexpression correlates with resistance to EGFR inhibitors (e.g., Erlotinib) in non-small cell lung cancer (NSCLC) .

  • Neuroscience: Promotes basal progenitor cell proliferation in the developing human neocortex via EGFR signaling .

  • Immunology: Enhances macrophage-mediated inflammation and wound healing .

Tools for Quantification

  • ELISA Kits: Detect EREG in serum and cell culture supernatants with a sensitivity range of 80–108% .

Cancer Therapeutics

  • Targeting EREG: Antibody-drug conjugates (ADCs) against EREG show efficacy in colorectal cancer models .

  • Cuproptosis Regulation: EREG modulates copper-induced cell death via FDX1 upregulation, a pathway under investigation in gliomas .

Tissue Engineering

  • Wound Healing: EREG accelerates keratinocyte proliferation and angiogenesis in diabetic ulcer models .

Key Research Findings

Study FocusKey ResultReference
EGFR SignalingEREG induces sustained ERK activation, unlike transient effects from EGF
Lung CancerHigh EREG expression predicts poor response to Erlotinib
Neural DevelopmentEREG deficiency reduces basal progenitor cells in human cerebral organoids
CuproptosisEREG-FDX1 axis promotes copper-dependent cell death in glioma

Challenges and Future Directions

  • Species Specificity: EREG is highly expressed in humans but absent in mice, complicating translational studies .

  • Therapeutic Resistance: Mechanisms of EREG-driven EGFR pathway reactivation require further elucidation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your specific needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for precise delivery timelines.
Note: All our proteins are standardly shipped with regular blue ice packs. For dry ice shipping, please notify us beforehand; additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Epiregulin; EPR; ER ; Ereg; EREG_HUMAN; Proepiregulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-169
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
VLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Uniprot No.

Target Background

Function
Epiregulin (EREG) is a ligand for the EGF receptor (EGFR) and ERBB4. It stimulates tyrosine phosphorylation of both EGFR and ERBB4. EREG plays a crucial role in various biological processes, including inflammation, wound healing, tissue repair, and oocyte maturation. It regulates angiogenesis and vascular remodeling, contributing to these processes by stimulating cell proliferation.
Gene References Into Functions
  1. In Caco-2 CFTR-shRNA cells, EREG, an EGFR ligand, is overexpressed due to an active IL-1beta autocrine loop that indirectly activates EGFR. This constitutes new signaling effectors for the CFTR signaling pathway, downstream of CFTR, Cl(-), and IL-1beta. PMID: 29091309
  2. We demonstrated that epidermal growth factor receptors (EGFR) are constitutively activated in metastatic lung subtypes of salivary adenoid cystic carcinoma cells. This activation is induced by autocrine expression of epiregulin. PMID: 26958807
  3. This study investigates how the EGFR ligands epiregulin (EREG) and epigen (EPGN) stabilize different dimeric conformations of the EGFR extracellular region. The findings reveal how responses to different EGFR ligands are defined by receptor dimerization strength and signaling dynamics. These insights have broader implications for understanding receptor tyrosine kinase (RTK) signaling specificity. PMID: 28988771
  4. EREG and MMP-1 were found to be elevated in nasal polyp and uncinate tissues in patients with Chronic rhinosinusitis with nasal polyps. PMID: 28398769
  5. Upregulation of EREG expression through promoter demethylation might be an important mechanism for activating the EGFR pathway during the genesis of colorectal adenocarcinoma (CRC) and potentially other cancers. PMID: 27270421
  6. EREG and AREG are strongly regulated by methylation, and their expression is associated with CIMP status and primary tumor site. PMID: 27272216
  7. This research examines the three-dimensional structure of the EPR antibody (the 9E5(Fab) fragment) in the presence and absence of EPR. PMID: 26627827
  8. Collectively, these studies identify a novel pathway involving EREG and MMP-1 that contributes to the formation of early-stage breast cancer. PMID: 26215578
  9. Data suggest that EREG is one of the molecules involved in glioma malignancy. PMID: 24470554
  10. Data indicate that the effects of epiregulin (EREG) and V-ATPase (TCIRG1) single nucleotide polymorphism (SNP) on pulmonary tuberculosis susceptibility, if present, are dependent on gene-gene interactions in West African populations. PMID: 24898387
  11. Patients homozygous for the minor allele A of EREG rs12641042 had a significantly higher 3-year survival rate compared to patients with allele C (HR 0.48; P=0.034), but significance was lost in multivariable analysis. PMID: 25203737
  12. Epiregulin is a transcriptional target of TSC2 (tuberin). PMID: 24748662
  13. Epiregulin promotes the proliferation of liver progenitor cells and DNA synthesis by hepatocytes. It is upregulated in the serum of patients with liver injury. PMID: 24812054
  14. Plasma HGF and EREG levels are associated with resistance to treatment with anti-EGFR antibodies in KRAS wild-type patients with metastatic colorectal cancer. PMID: 24800946
  15. Data suggest that EREG (epiregulin), AREG (amphiregulin), and BTC (betacellulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells. PMID: 24092824
  16. In pre-treated K-ras wild-type status colorectal cancer, patients with high EREG gene expression appear to benefit more from cetuximab therapy compared to those with low expression. PMID: 24335920
  17. EREG might contribute to glioma progression under the control of IRE1a. PMID: 24330607
  18. Keratinocyte hyperproliferation in cholesteatoma is promoted through overexpression of epiregulin by subepithelial fibroblasts via epithelial-mesenchymal interactions, which may play a crucial role in the pathogenesis of middle ear cholesteatoma. PMID: 23826119
  19. Depletion of Epiregulin with shRNA inhibited SCAP proliferation. PMID: 23829318
  20. Data indicate that epiregulin (EREG) expression significantly correlated with KRAS expression or KRAS copy number in KRAS-mutant non-small-cell lung cancer (NSCLC) cell lines. PMID: 22964644
  21. EREG-AREG and NRG1, which are members of the epidermal growth factor (EGF) family, seem to modulate Behçet's Disease susceptibility through main effects and gene-gene interactions. PMID: 23625463
  22. We did not find a correlation between the presence of a K-ras mutation and the presence of Epiregulin and Amphiregulin in colon cancer tissue. PMID: 23885463
  23. Apical mistrafficking of EREG crystallizes an apical EGFR signaling complex that may be uncoupled from basolateral regulatory restraints leading to cell transformation. PMID: 23671122
  24. FBXL11 inhibited osteo/dentinogenic differentiation potential in MSC cells by associating with BCOR, then increasing histone K4/36 methylation in Epiregulin promoter to repress Epiregulin transcription. PMID: 23074094
  25. EREG gene expression was low in 7 out of 11 gastric cancer cells, and this downregulation was mediated by aberrant CpG methylation of the EREG promoter. PMID: 22508389
  26. Epiregulin (EREG) variation is associated with susceptibility to tuberculosis. PMID: 22170233
  27. Data suggest that expression status of AR and EPI mRNAs might be evaluated as dynamic predictors of response in KRAS WT patients receiving any cetuximab-based therapy. PMID: 21161326
  28. It is suggested that follow-up of the expression of Ep can serve as a reliable early indication of the development of ovarian cancer. PMID: 21769422
  29. Blockade of epiregulin reduced the growth of hTERT-BJ cells and colony formation of hTERT-transformed fibroblasts. Moreover, inhibition of epiregulin function in immortal hTERT-BJ cells triggered a senescence program. PMID: 12702554
  30. Epiregulin might be a more important tumor growth regulator of malignant fibrous histiocytoma through autocrine or paracrine pathways compared to betacellulin. PMID: 15274392
  31. Upregulation of the epiregulin and amphiregulin expression is part of the signal transduction pathway that leads to ovulation and luteinization in the human ovary. PMID: 15474502
  32. Findings demonstrated that PGE2 may mimic LH action, at least in part, by the activation of amphiregulin and epiregulin biosynthesis in human granulosa cells. PMID: 16888076
  33. Epiregulin, COX2, and MMP1 and 2 collectively facilitate the assembly of new tumor blood vessels, the release of tumor cells into the circulation, and the breaching of lung capillaries by circulating tumor cells to seed pulmonary metastasis. PMID: 17429393
  34. This is the first report of EREG expression in breast cancer (45.5% of breast cancers studied). It is preferentially expressed in breast tumors co-expressing HER2/HER4. PMID: 17962208
  35. Epiregulin played an autocrine role in the proliferation of corneal epithelial cells, presumably through cross-induction with other EGF family members. PMID: 18079685
  36. Hamartomatous TSC skin tumors are induced by paracrine factors released by two-hit cells in the dermis, and proliferation with mTOR activation of the overlying epidermis is an effect of epiregulin. PMID: 18292222
  37. Increased epiregulin is associated with oral squamous cell carcinomas. PMID: 18497965
  38. Epiregulin has a protective effect against apoptosis in the human corpus luteum. PMID: 18835871
  39. The regulatory mechanism of epiregulin expression in Ki-ras-transformed 267B1 prostate epithelial cells was studied. PMID: 18948081
  40. Epiregulin expression correlates with advanced disease, is EGFR dependent, and confers invasive properties on non-small cell lung cancer cells. PMID: 19138957

Show More

Hide All

Database Links

HGNC: 3443

OMIM: 602061

KEGG: hsa:2069

STRING: 9606.ENSP00000244869

UniGene: Hs.115263

Subcellular Location
[Epiregulin]: Secreted, extracellular space.; [Proepiregulin]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.

Q&A

What is Recombinant Human Proepiregulin (EREG) and what are its primary biological functions?

EREG, encoding the growth factor EPIREGULIN, is initially synthesized as a membrane-anchored precursor that is subsequently released from the cell surface by the metalloproteinase ADAM17. EPIREGULIN functions as a growth factor that has been implicated in regulating cell proliferation, differentiation, and cell death in multiple biological contexts .

EPIREGULIN has demonstrated significant roles in diverse physiological processes, including angiogenesis, skin inflammation, ovarian follicle formation, and has been implicated in cancer biology . One of its primary functions appears to be cellular proliferation regulation, particularly in neural progenitor cells of primates and in dermal papilla cells involved in hair growth .

Notably, while EPIREGULIN plays important roles in these processes, the knockout of the Ereg gene in mice does not result in overt developmental phenotypes, suggesting potential functional redundancy with other growth factors in some contexts .

How does EREG expression differ across species and developmental contexts?

EREG shows distinct expression patterns across species, with significant interspecies variations that may have evolutionary implications. Current research demonstrates that EREG is expressed in the developing neocortex of humans and in gorilla cerebral organoids but is notably absent in the mouse neocortex .

Analysis of RNA-seq data has shown similar expression levels of EREG mRNA in both macaque and human neural progenitor cells, indicating conservation among primates . Interestingly, EREG expression has also been observed in the germinal zones of ferrets, which possess an expanded outer subventricular zone (OSVZ) .

These expression differences correlate with neocortical complexity - EREG is expressed in species with expanded and highly folded neocortices (gyrencephalic) but not in those with small, smooth neocortices (lissencephalic), suggesting its potential role in neocortical expansion during evolution .

What signaling pathways does EREG activate and how do they differ from other EGF family ligands?

EPIREGULIN primarily signals through the epidermal growth factor receptor (EGFR) pathway. Research indicates that EPIREGULIN competes with EGF (epidermal growth factor) to promote cellular proliferation, particularly in basal progenitor cells . When the EGF receptor is inhibited, the EPIREGULIN-mediated increase in basal progenitor cells is abrogated, confirming the necessity of EGFR signaling for EPIREGULIN function .

In addition to EGFR, EPIREGULIN can activate ErbB4 receptors, as evidenced in dermal papilla cells (DPCs) where EREG treatment results in ErbB4 phosphorylation . This activation of ErbB4 appears to be cell-type specific, as outer root sheath (ORS) cells did not show phospho-ErbB4 positive cells after EREG treatment despite both cell types being involved in hair follicle biology .

EPIREGULIN stimulation also leads to increased cellular reactive oxygen species (ROS) levels, though interestingly, this increase does not appear to originate from mitochondria as demonstrated by MitoSOX staining patterns .

What concentrations of recombinant EPIREGULIN are optimal for in vitro and ex vivo studies?

Based on experimental evidence, the optimal concentration of recombinant EPIREGULIN varies depending on the experimental model and research question. In mouse neocortex organotypic slice cultures, researchers tested three concentrations (10, 50, and 100 ng/mL) and found that 50 ng/mL produced the highest increase in abventricular phospho-histone 3 (PH3)-positive cells compared to control conditions . This intermediate concentration was subsequently used for further experiments in that model.

For hair growth studies, 100 ng/mL of EPIREGULIN was injected daily into the dorsal skin of shaved mice to investigate its effects on hair follicle development . In vitro studies with dermal papilla cells showed dose-dependent effects, with EPIREGULIN increasing DPC proliferation up to 2-fold across a range of concentrations .

When working with human fetal cortical tissue in free-floating tissue culture (FFTC) systems, researchers used 50 ng/mL EPIREGULIN for 24-hour incubation periods, though this treatment duration may not have been sufficient given the longer cell cycle length of primate neural progenitor cells compared to mouse neural progenitor cells .

What methodologies are effective for manipulating EREG expression in experimental models?

Several methodologies have proven effective for manipulating EREG expression in research contexts:

  • CRISPR/Cas9 gene editing: Researchers have successfully disrupted EREG expression in human cortical organoids by injecting guide RNAs (gRNAs) in complex with recombinant Cas9 protein into ventricle-like structures followed by electroporation. This approach demonstrated efficient targeting both in vitro and in the iPSC lines used to generate cortical organoids .

  • RNA interference: For in vivo studies, negative control or siRNA for EREG (480 pmol per mouse) has been injected with in vivo-JetRNA into the dorsal skin of shaved mice to knockdown EREG expression .

  • Recombinant protein administration: Direct application of recombinant EPIREGULIN protein has been used in multiple experimental models, including organotypic slice cultures, HERO (hemisphere rotation) cultures, and free-floating tissue cultures. This approach allows for precise dosage control and temporal manipulation of EPIREGULIN signaling .

  • Cell-based delivery: Modified cells with altered EREG expression profiles can be injected into experimental models, as demonstrated by injection of EREG-treated dermal papilla cells .

How should researchers control for species-specific differences when studying EREG function?

When investigating EREG function across species, researchers should implement several control strategies to account for species-specific differences:

First, it is essential to characterize EREG expression patterns in the species being compared. As demonstrated in the search results, EREG is expressed in primate neocortex and gorilla cerebral organoids but not in mouse neocortex . This fundamental difference must be accounted for when interpreting experimental results.

Second, researchers should consider using multiple complementary models within the same study. For example, combining in vivo animal models, ex vivo tissue cultures, and in vitro organoid systems derived from different species can provide comprehensive insights into species-specific functions of EREG .

Third, the cell cycle length varies significantly between species (e.g., primate neural progenitor cells have a much longer cell cycle than mouse neural progenitor cells) . Therefore, experimental timeframes should be adjusted accordingly when comparing EREG effects across species.

Finally, when using recombinant EPIREGULIN, researchers should verify that the protein is functional in the target species. This may involve confirming receptor binding, downstream signaling activation, or established biological responses in positive control experiments.

How does EPIREGULIN influence neural progenitor cell proliferation in developing neocortex?

EPIREGULIN plays a significant role in promoting the proliferation of neural progenitor cells (NPCs), particularly basal progenitors (BPs) in the subventricular zone (SVZ) of the developing neocortex. The effects of EPIREGULIN on neural progenitors are primarily observed in the SVZ rather than the ventricular zone (VZ), suggesting cell-type specificity in its action .

When recombinant EPIREGULIN was added to mouse neocortex cultures, researchers observed:

  • A significant increase in the total number of mitotic cells, as indicated by phospho-histone 3 (PH3) staining

  • A strong increase in abventricular mitosis (defined as more than three nuclei away from the ventricular surface)

  • Increased percentages of Ki67- and PCNA-positive cells specifically in the SVZ/intermediate zone (IZ), but not in the VZ

  • Expansion of both major types of basal progenitors: basal intermediate progenitors (bIPs, characterized by Tbr2 expression and lack of processes) and basal radial glia (bRG, marked by Sox2 expression and the presence of processes)

Conversely, when EREG was ablated in human cortical organoids using CRISPR/Cas9, a significant reduction in the percentage of KI67-positive cells was observed specifically in the SVZ/cortical plate (CP)-like region, but not in the VZ. Both SOX2 and TBR2 expression were reduced upon EREG targeting in the SVZ/CP, further supporting EPIREGULIN's role in maintaining both BP types .

This specificity for basal progenitors may be particularly significant in the context of neocortical evolution, as the expansion of basal progenitors is associated with neocortical enlargement in gyrencephalic species .

What are the putative cis-regulatory elements that may contribute to species-specific EREG expression?

Research has identified putative cis-regulatory elements that may contribute to the observed interspecies differences in EREG expression patterns, although the search results do not provide detailed information about these specific elements . These regulatory regions likely play crucial roles in controlling the spatial and temporal expression of EREG across different species.

The presence of EREG in primates and ferrets (gyrencephalic species) but not in mice (lissencephalic species) suggests that these regulatory elements emerged or were modified during evolution in correlation with increased neocortical complexity . Understanding these regulatory mechanisms could provide insights into the evolutionary processes that contributed to neocortical expansion in primates.

Future research directions should include comparative genomic analyses to identify conserved and divergent regulatory sequences in the EREG locus across species, epigenetic profiling to characterize the chromatin landscape around EREG in different species and cell types, and functional validation of candidate regulatory elements using reporter assays and genome editing approaches.

What is the relationship between EREG expression and brain tumors?

EREG expression has been implicated in brain tumor biology, particularly in gliomas. Although EREG expression is not inherently increased in glioblastoma compared to normal brain tissue, it shows differential expression patterns in various tumor grades .

Evidence from multiple studies indicates that EREG expression is higher in high-grade compared to low-grade glioma, and loss of EREG correlates with increased patient survival . This suggests that EPIREGULIN may contribute to the aggressive behavior of high-grade gliomas.

In a mouse model of glioblastoma, Epiregulin was shown to enhance tumorigenicity by activating the ERK/MAPK pathway . This aligns with EPIREGULIN's known role in promoting cell proliferation, particularly in progenitor cell populations.

The connection between EREG's normal developmental function in neural progenitor proliferation and its potential role in brain tumors highlights how developmental programs can be co-opted during tumorigenesis. Understanding these relationships could potentially lead to therapeutic strategies targeting EREG or its downstream pathways in brain tumors.

How does EPIREGULIN contribute to hair growth regulation and what mechanisms are involved?

EPIREGULIN demonstrates significant activity in promoting hair growth through multiple mechanisms. Research has shown that EREG can promote hair growth both in vivo and ex vivo, as demonstrated by experiments using human recombinant EREG or knockdown of EREG .

The primary mechanism appears to involve EPIREGULIN's activation of ErbB4 receptors specifically on dermal papilla cells (DPCs), which are key regulators of hair follicle growth and cycling. More than 95% of DPCs showed phosphorylated ErbB4 within 15 minutes of EREG treatment, while outer root sheath (ORS) cells showed no phospho-ErbB4 positive cells even after EREG treatment . This specificity is supported by significantly higher expression levels of ERBB4 mRNA in DPCs compared to ORS cells .

EPIREGULIN stimulation leads to:

  • Dose-dependent increases in DPC proliferation (up to 2-fold)

  • Upregulation of DPC marker genes

  • Increased cellular reactive oxygen species (ROS) levels

Interestingly, the increased ROS levels induced by EREG do not appear to originate from mitochondria, as MitoSOX signals were not detected in mitochondria after EREG treatment. Instead, some MitoSOX signals were detected inside the nucleus, which aligns with previous reports about increased NOX4 expression in the nucleus of DPCs .

This suggests that EPIREGULIN may regulate hair growth by stimulating DPC proliferation and function through ErbB4 activation and subsequent modulation of redox signaling pathways.

What challenges exist in comparing EREG functions across different tissue types?

Comparing EREG functions across different tissue types presents several methodological and interpretive challenges:

First, EREG's effects appear to be highly context-dependent, with significant variations in its impact depending on the cell type and developmental stage. For example, EREG promotes proliferation of neural progenitors in the developing neocortex and stimulates dermal papilla cells in hair follicles , but these effects may involve different downstream mechanisms.

Second, receptor expression varies across tissues, which influences cellular responsiveness to EREG. While EREG signals primarily through the EGF receptor, it can also activate ErbB4 as seen in DPCs . The distribution and relative abundance of these receptors across different tissues must be considered when comparing EREG functions.

Third, the temporal dynamics of EREG signaling may differ between tissue types. Neural progenitor cells in primates have much longer cell cycle lengths than those in mice , which affects the timeframe in which EREG effects can be observed. Similar differences may exist between other tissue types.

Finally, the presence of other growth factors that may compete with or complement EREG signaling varies across tissues. EREG competes with EGF in neural progenitor proliferation , but similar interactions may not be present or may involve different growth factors in other contexts.

These challenges highlight the importance of using tissue-specific experimental designs and interpretive frameworks when studying EREG functions across different biological systems.

How can researchers distinguish between direct and indirect effects of EREG in experimental systems?

Distinguishing between direct and indirect effects of EPIREGULIN requires multiple complementary approaches:

First, researchers should perform time-course experiments to identify immediate versus delayed responses to EPIREGULIN treatment. Direct effects typically manifest rapidly, as seen with ErbB4 phosphorylation occurring within 15 minutes of EREG treatment in DPCs .

Second, combining gain and loss of function experiments provides stronger evidence for direct effects. For example, both the addition of recombinant EPIREGULIN to mouse neocortex cultures and the ablation of EREG in human cortical organoids affected basal progenitor proliferation, strongly suggesting a direct role for EPIREGULIN in this process .

Third, pathway inhibition studies can help establish causality. The demonstration that inhibition of the EGF receptor abrogates the EPIREGULIN-mediated increase in basal progenitor cells confirms that EGFR signaling is necessary for this effect .

Fourth, researchers should assess the expression of EPIREGULIN receptors in target cells. The high expression of ERBB4 in DPCs compared to ORS cells explains the specific responsiveness of DPCs to EPIREGULIN .

Finally, cell-specific manipulations, such as conditional knockout or overexpression in distinct cell populations, can help determine which effects are cell-autonomous (direct) versus non-cell-autonomous (indirect).

What methods are most appropriate for analyzing EREG-induced changes in proliferation across different experimental models?

Analysis of EREG-induced proliferation changes requires thoughtful selection of markers and methods appropriate to each experimental model:

For fixed tissue samples and organoids, immunofluorescence analysis of multiple proliferation markers provides comprehensive insights:

  • Phospho-histone 3 (PH3) specifically marks mitotic cells

  • Ki67 labels all cycling cells throughout the cell cycle

  • Proliferating cell nuclear antigen (PCNA) marks cells in S-phase and is useful for identifying actively replicating cells

  • Combined with cell-type specific markers (e.g., Sox2 for radial glia, Tbr2 for intermediate progenitors), these proliferation markers allow identification of which specific cell populations respond to EREG

For analyzing morphological features of proliferating cells, techniques like hemisphere rotation (HERO) cultures followed by thick-section imaging enable visualization of cellular processes, which is particularly important for identifying basal radial glia .

For live-cell analysis, time-lapse imaging of reporter-expressing cells can provide dynamic information about cell cycle progression and division patterns after EREG treatment.

For quantitative assessment in cell culture systems, conventional proliferation assays can measure dose-dependent effects of EREG, as demonstrated in studies showing up to 2-fold increases in DPC proliferation with varying EREG concentrations .

When studying proliferation in primate versus rodent systems, researchers must account for significant differences in cell cycle length. The much longer cell cycle of primate neural progenitors means that experimental timeframes must be extended accordingly when working with human or other primate samples .

What future research directions could advance our understanding of EREG biology?

Several promising research directions could significantly advance our understanding of EREG biology:

  • Evolutionary studies: Further investigation of the putative cis-regulatory elements that contribute to species-specific EREG expression patterns could provide insights into the evolutionary mechanisms underlying neocortical expansion in primates .

  • Single-cell omics approaches: Application of single-cell RNA sequencing and ATAC-seq to identify cell-type specific responses to EREG and characterize the gene regulatory networks activated by EPIREGULIN signaling.

  • In vivo functional studies across species: Development of humanized mouse models expressing EREG in patterns mimicking human expression could help determine if this factor alone is sufficient to induce primate-like features in the mouse neocortex.

  • Receptor specificity studies: Detailed investigation of how EPIREGULIN interacts with different ErbB receptors (EGFR, ErbB4) across cell types and how these interactions differ from other EGF family ligands.

  • Therapeutic applications: Exploration of EREG as a potential target in conditions such as glioblastoma, where its expression correlates with poor prognosis , or as a therapeutic agent in conditions that might benefit from its proliferation-promoting effects, such as wound healing or hair loss .

  • Long-term effects of EREG signaling: Investigation of how transient EREG signaling affects cell fate decisions and long-term tissue architecture beyond its immediate effects on proliferation.

  • Interaction with other signaling pathways: Comprehensive analysis of how EREG signaling interacts with other developmentally relevant pathways, such as Notch, Wnt, and Sonic hedgehog, to coordinate tissue development and homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.