Recombinant Human Progestin and adipoQ receptor family member 3 (PAQR3)

Shipped with Ice Packs
In Stock

Description

Introduction to PAQR3 and Its Recombinant Form

PAQR3 is a Golgi-anchored membrane protein with seven transmembrane helices, classified as a tumor suppressor. It regulates pathways such as Raf/MEK/ERK and PI3K/AKT, inhibiting cell proliferation and promoting apoptosis in cancers . The recombinant form is engineered for research, typically expressed in wheat germ or tobacco plants with tags (e.g., GST, Strep) to facilitate purification and functional studies .

Production and Characterization of Recombinant PAQR3

Recombinant PAQR3 is produced via heterologous expression systems, optimized for structural integrity and functional activity. Key parameters include:

ParameterDetailsSource
Host OrganismWheat germ, tobacco (Nicotiana tabacum)
TagGST (N-terminal), Strep
Purity>80% via SDS-PAGE, Western blot, and SEC (HPLC)
Buffer50 mM Tris-HCl, 10 mM reduced glutathione, pH 8.0 (elution buffer)
Storage-80°C (avoid repeated freeze-thaw cycles)

Key Features:

  • Expressed as full-length protein (AA 1-269) with GST tag .

  • Purified via affinity chromatography (e.g., glutathione resin for GST-tagged proteins) .

  • Validated for use in ELISA, Western blot, and antibody array applications .

Functional Roles and Mechanisms of PAQR3

PAQR3 modulates cellular processes through interactions with signaling pathways:

Tumor Suppression

PAQR3 inhibits oncogenic pathways, including:

  • PI3K/AKT: Suppression of phosphorylated PI3K and Akt reduces proliferation and survival in glioma (U251 cells) and NSCLC (A549/H1299) .

  • Raf/MEK/ERK: Sequestration of Raf-1 to the Golgi attenuates ERK activation, blocking tumor growth .

Metabolic Regulation

  • Insulin Sensitivity: PAQR3 knockout in mice improves HFD-induced obesity and hepatic steatosis, enhancing glucose/lipid metabolism .

  • Diabetic Nephropathy: Reduces fibronectin (FN) and ICAM-1 expression via NF-κB pathway inhibition, mitigating renal fibrosis .

Cholesterol Homeostasis

PAQR3 anchors the SCAP/SREBP complex to the Golgi under low cholesterol, modulating lipid metabolism .

Applications in Research Studies

Recombinant PAQR3 is pivotal in elucidating its therapeutic potential:

Cancer TypeCell Line/ModelPAQR3 EffectMechanismSource
GliomaU251, xenograftInhibits proliferation, migration, invasionPI3K/AKT suppression
NSCLCA549, H1299Induces apoptosis, G0/G1 arrestPI3K/AKT inhibition
Diabetic NephropathyGMCs (HG-treated)Reduces FN/ICAM-1 via NF-κB inhibitionIKKβ interaction disruption

Key Findings:

  • Overexpression: Inhibits tumor growth in glioma xenografts .

  • Knockdown: Promotes NSCLC cell proliferation and reduces apoptosis .

  • Therapeutic Target: Potential for treating cancers and metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PAQR3; Progestin and adipoQ receptor family member 3; Progestin and adipoQ receptor family member III; Raf kinase trapping to Golgi; RKTG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PAQR3
Target Protein Sequence
MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCI KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCML CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA MILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRV IVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRH SKPCPDYVSHL
Uniprot No.

Target Background

Function
PAQR3 functions as a spatial regulator of RAF1 kinase by sequestering it to the Golgi apparatus.
Gene References Into Functions
  1. Ubiquitination modification through the coordinated action of PAQR3 with HUWE1 plays a vital role in regulating the activity of hepatic PPARalpha in response to starvation. PMID: 29331071
  2. Silencing of PAQR3 suppresses extracellular matrix accumulation in high glucose-stimulated human glomerular mesangial cells via the PI3K/AKT signaling pathway. PMID: 29787774
  3. PAQR3 shows promise as a potential methylation marker candidate for the detection and monitoring of prostate cancer. PMID: 29122400
  4. PAQR3 is epigenetically silenced in esophageal squamous cell carcinoma (ESCC), and its restoration suppresses the aggressive phenotype of ESCC cells. PMID: 28802234
  5. Low expression of PAQR3 is associated with gastric cancer metastasis. PMID: 28560431
  6. Data suggest that PAQR3 expression is downregulated in glioma tissues and cell lines. PAQR3 overexpression suppresses cell migration of glioma cells, inhibits invasiveness in xenograft experiments, and prevents epithelial-mesenchymal transition. PMID: 28528182
  7. Our study highlights that PAQR3 functions as an adaptor protein to promote Nrf2-Keap1 complex formation, thereby modulating the Nrf2-Keap2 pathway and playing a significant role in controlling the cell's antioxidant response. PMID: 27212020
  8. This finding reveals a novel mode of regulation of mTORC1 signaling and autophagy by PAQR3 in response to alterations of amino acids. PMID: 28214587
  9. Our research demonstrates that overexpression of PAQR3 suppresses cell proliferation, migration, and invasion in esophageal cancer in vitro and in vivo. PMID: 28548040
  10. PAQR3 protein expression is significantly decreased in lung cancer. PMID: 28442015
  11. Our results indicate that aberrant methylation of PAQR3 underlies its downregulation in breast cancer, suggesting that epigenetic silencing of PAQR3 gene expression by promoter hypermethylation may play a significant role in breast cancer development. PMID: 27461225
  12. PAQR3 plays a tumor suppressive role in laryngeal squamous cell carcinoma. PMID: 26232324
  13. A novel role has been discovered for the newly characterized, Golgi-localized PAQR3 in regulating heterotrimeric G-proteins at the non-canonical subcellular location of the Golgi. PMID: 26327583
  14. Our findings not only pinpoint that Twist1 mediates the modulatory function of PAQR3 on EMT and metastasis but also suggest that targeting Twist1 is a promising strategy to control metastasis of tumors with downregulation of PAQR3. PMID: 26905590
  15. PAQR3 regulates cholesterol homeostasis by anchoring Scap/SREBP to the Golgi, and disruption of this function reduces cholesterol biosynthesis. PMID: 26311497
  16. Our data indicate that PAQR3 functions as a tumor suppressor in the development of human breast cancers. PMID: 25900239
  17. DDB2 is involved in ubiquitination and degradation of PAQR3 in gastric cancer cells. PMID: 26205499
  18. PAQR3 is significantly downregulated in human gastric cancers. PAQR3 expression levels are closely associated with the progression and metastasis of gastric cancers. PMID: 24799462
  19. PAQR3 may act as a tumor suppressor in osteosarcoma. PMID: 25510670
  20. PAQR3 may play a crucial role in the progression of hepatocellular carcinoma and serve as a potential candidate for targeted therapy of this cancer. PMID: 25310770
  21. PAQR3 (progestin and adipoQ receptors member 3), a tumor suppressor specifically localized in the Golgi apparatus, negatively regulates H3K4 trimethylation (H3K4me3). PMID: 25706881
  22. MicroRNA-137 upregulation increases bladder cancer cell proliferation and invasion by targeting PAQR3. PMID: 25330156
  23. Loss of PAQR3 is associated with tumorigenesis of colorectal cancers. PMID: 22828136
  24. RKTG can modulate GPCR signaling by sequestering G betagamma to the Golgi apparatus, thereby attenuating the functions of G betagamma. PMID: 19884349
  25. Research reveals a paradigm of spatial regulation of Raf kinase by RKTG through sequestering Raf-1 to the Golgi apparatus and thereby inhibiting the ERK signaling pathway. PMID: 17724343
  26. RKTG may play a suppressive role in human melanoma harboring an oncogenic B-Raf mutation via its antagonistic action on B-Raf. PMID: 18515281
  27. This research provides a detailed analysis of the topology and functional domains of RKTG (Raf kinase trapping to Golgi). PMID: 18547165
  28. Data show that adiponectin functions as an agonist of PAQR3. PMID: 19519172

Show More

Hide All

Database Links

HGNC: 30130

OMIM: 614577

KEGG: hsa:152559

STRING: 9606.ENSP00000421981

UniGene: Hs.657312

Protein Families
ADIPOR family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed in a range of tissues.

Q&A

What is PAQR3 and what is its cellular localization?

PAQR3 (Progestin and AdipoQ Receptor family member 3) is a seven-transmembrane protein that belongs to the highly conserved PAQR family comprising 11 members (PAQR1 to PAQR11). It functions primarily as a tumor suppressor and is also known as RKTG (Raf Kinase Trapping to Golgi). PAQR3 is a type III membrane protein specifically localized in the Golgi apparatus of mammalian cells, which is critical for its function in sequestering signaling molecules away from their activation sites . This Golgi-specific localization distinguishes PAQR3 from other family members and plays a key role in its ability to regulate various signaling pathways, particularly the Ras/Raf/MEK/ERK cascade. The protein's transmembrane domains anchor it in the Golgi membrane, while its functional domains interact with various signaling molecules, thereby regulating their availability and activity in the cytoplasm .

How does PAQR3 expression differ between normal and cancerous tissues?

Analysis of the TCGA database containing 498 prostate adenocarcinoma samples and 52 normal prostate tissue samples reveals significantly lower expression of PAQR3 in prostate cancers compared to normal tissues . This pattern of decreased expression has been consistently observed across multiple cancer types including colon cancer, gastric cancer, bladder cancer, liver cancer, osteosarcoma, breast cancer, and laryngeal squamous cell carcinoma . The downregulation of PAQR3 in these malignancies supports its proposed role as a tumor suppressor. The following table summarizes reported PAQR3 expression patterns across different cancer types:

Cancer TypePAQR3 ExpressionReference Citation
Prostate adenocarcinomaSignificantly decreasedTCGA database analysis
Colon cancerDownregulatedMultiple studies
Gastric cancerDownregulatedMultiple studies
Bladder cancerDownregulatedMultiple studies
Liver cancerDownregulatedMultiple studies
OsteosarcomaDownregulatedMa et al., 2015
Breast cancerDownregulatedLi et al., 2015
Laryngeal squamous cell carcinomaDownregulatedWu et al., 2016

What signaling pathways does PAQR3 regulate?

PAQR3 regulates multiple signaling cascades critical for cell proliferation, survival, and migration. Primarily, it acts as a negative regulator of the Ras/Raf/MEK/ERK pathway by sequestering Raf-1 to the Golgi apparatus, thus preventing its interaction with Ras and subsequent activation of downstream effectors . Additionally, PAQR3 inhibits the PI3K/AKT pathway through at least two distinct mechanisms, thereby suppressing cell survival signals .

The protein also influences the epithelial-mesenchymal transition (EMT) process by modulating the expression of EMT markers - increasing epithelial markers (E-cadherin, ZO-1) while decreasing mesenchymal markers (vimentin) . PAQR3 has been shown to functionally interact with p53 in cancer formation and EMT regulation, and recent studies indicate it can regulate ubiquitination and degradation of Twist1, a master regulator of EMT in gastric cancer cells . This multi-pathway regulatory capacity positions PAQR3 as a critical node in cellular signaling networks relevant to cancer progression.

What molecular mechanisms underlie PAQR3's inhibition of tumor cell proliferation?

PAQR3 inhibits tumor cell proliferation through several interconnected molecular mechanisms:

  • Inhibition of Ras/Raf/MEK/ERK Signaling: PAQR3 physically interacts with and sequesters Raf-1 to the Golgi apparatus, preventing its activation by Ras and subsequent propagation of mitogenic signals through MEK and ERK . In prostate cancer cell lines (PC3 and DU145), PAQR3 overexpression significantly reduces serum-induced ERK phosphorylation, while PAQR3 knockdown enhances it .

  • Suppression of PI3K/AKT Pathway: PAQR3 inhibits AKT activation, a crucial survival pathway in cancer cells. In prostate cancer cells, PAQR3 overexpression substantially reduces AKT phosphorylation in response to serum stimulation .

  • Cell Cycle Regulation: Though not explicitly detailed in the provided search results, PAQR3's inhibition of ERK and AKT likely leads to reduced expression of cell cycle proteins and increased expression of cell cycle inhibitors, culminating in reduced proliferation.

  • Anti-EMT Effects: By suppressing EMT, PAQR3 may maintain a more differentiated cellular phenotype less prone to rapid proliferation .

The experimental evidence for these mechanisms comes from both in vitro studies using cell lines and in vivo xenograft models. In PC3 and DU145 prostate cancer cells, PAQR3 overexpression significantly reduced proliferation rates as measured by MTT assays and colony formation assays, while PAQR3 knockdown enhanced proliferation. These findings demonstrate that PAQR3 levels are inversely correlated with prostate cancer cell proliferation capacity .

How does PAQR3 influence tumor cell migration and metastasis?

PAQR3 exerts significant inhibitory effects on tumor cell migration and potentially on metastasis through several mechanisms:

  • Regulation of EMT: In PC3 prostate cancer cells, PAQR3 overexpression suppresses EMT features by increasing epithelial markers (E-cadherin and ZO-1) while decreasing mesenchymal markers (vimentin) . Conversely, PAQR3 knockdown produces the opposite effect, enhancing mesenchymal characteristics associated with increased migratory capacity .

  • Interaction with EMT Regulators: PAQR3 functionally interacts with p53, which plays a role in EMT regulation. Furthermore, PAQR3 can regulate the ubiquitination and degradation of Twist1, a master regulator of EMT in gastric cancer cells . This suggests a molecular mechanism by which PAQR3 may control cell migration.

  • Inhibition of Migration-Related Signaling: By suppressing both ERK and AKT signaling pathways, PAQR3 likely inhibits the activation of downstream migration-promoting factors and cytoskeletal remodeling proteins required for cell movement .

Experimental evidence from wound-healing and transwell assays demonstrates that PAQR3 overexpression significantly reduces the migration of PC3 and DU145 prostate cancer cells, while PAQR3 knockdown enhances their migratory capacity . These findings indicate that PAQR3 acts as a negative regulator of cell migration, which is consistent with its role as a tumor suppressor.

While direct evidence of PAQR3's impact on metastasis was not detailed in the provided search results, its inhibitory effects on EMT and cell migration strongly suggest it may suppress metastatic potential. Future research should focus on in vivo metastasis models to confirm this hypothesis.

What is the role of PAQR3 in tumor xenograft models?

In tumor xenograft models, PAQR3 demonstrates significant tumor-suppressive activity, consistent with its in vitro effects. When PC3 prostate cancer cells with stable PAQR3 overexpression were implanted into nude mice, tumor growth was markedly reduced compared to control cells . Specifically:

  • Tumor Size and Volume: PAQR3 overexpression significantly reduced tumor size and volume in xenograft models over a 25-day period .

  • Tumor Weight: Tumors derived from PAQR3-overexpressing cells exhibited significantly lower weights compared to control tumors .

  • Dose-Dependent Effects: Conversely, when PAQR3 was knocked down in PC3 cells, the resultant xenograft tumors displayed increased size, weight, and volume compared to control tumors, demonstrating a dose-dependent relationship between PAQR3 levels and tumor growth .

These in vivo findings provide compelling evidence that PAQR3's tumor-suppressive effects observed in vitro translate to the more complex tumor microenvironment of living organisms. The xenograft model results suggest that PAQR3 may have therapeutic potential for prostate cancer treatment, potentially through gene therapy approaches or through pharmacological agents that mimic or enhance PAQR3 activity .

The following table summarizes the effects of PAQR3 manipulation in prostate cancer xenograft models:

PAQR3 StatusEffect on Tumor SizeEffect on Tumor WeightEffect on Tumor Volume
OverexpressionSignificantly decreasedSignificantly decreasedSignificantly decreased
KnockdownSignificantly increasedSignificantly increasedSignificantly increased

What techniques are used to establish stable PAQR3 expression or knockdown in cancer cells?

Researchers employ several complementary techniques to manipulate PAQR3 expression in cancer cell lines:

  • Lentivirus-Based Stable Overexpression: For stable PAQR3 overexpression, a lentivirus-based method is commonly used. This approach involves cloning the full-length PAQR3 cDNA into a lentiviral expression vector, producing viral particles in packaging cells (such as HEK293T), and then infecting target cancer cells (e.g., PC3 and DU145 prostate cancer cell lines) . Following infection, cells are typically selected using appropriate antibiotics to establish stable cell clones with consistent PAQR3 overexpression.

  • shRNA-Mediated Knockdown: For PAQR3 knockdown, short hairpin RNA (shRNA) technology is employed. PAQR3-specific shRNA sequences are designed and cloned into lentiviral vectors, followed by viral production and target cell infection . After selection, stable cell lines with significantly reduced PAQR3 expression are established.

  • Verification Methods:

    • Quantitative RT-PCR: To confirm successful manipulation of PAQR3 at the mRNA level, measuring fold changes in expression compared to control cells .

    • Western Blotting: To verify changes in PAQR3 protein expression, using specific antibodies against PAQR3 .

When establishing these modified cell lines, researchers should consider several important factors:

  • Selection of appropriate control vectors (empty vector controls for overexpression studies and non-targeting shRNA for knockdown studies)

  • Testing multiple shRNA sequences to identify those with optimal knockdown efficiency

  • Establishing multiple independent clones to ensure results are not due to clonal effects

  • Regular verification of maintained expression/knockdown throughout experimental use of the cells

These techniques provide powerful tools for investigating PAQR3 function in cancer biology and are essential for both in vitro and in vivo studies of this tumor suppressor .

What assays are most effective for measuring PAQR3's effects on cell proliferation?

Several complementary assays are used to comprehensively evaluate PAQR3's effects on cancer cell proliferation:

  • MTT Assay: This colorimetric assay measures metabolic activity as a proxy for cell viability and proliferation. In studies with PC3 and DU145 prostate cancer cells, MTT assays revealed significantly reduced proliferation rates in PAQR3-overexpressing cells compared to control cells, while PAQR3 knockdown enhanced proliferation . The assay typically involves measuring absorbance at specific timepoints (e.g., 24h, 48h, 72h) to generate growth curves.

  • Colony Formation Assay: This assay assesses the long-term proliferative capacity and clonogenic potential of cells. PAQR3 overexpression significantly reduced colony formation in PC3 and DU145 cells, while PAQR3 knockdown enhanced it . The assay typically involves seeding cells at low density, allowing colonies to form over 1-2 weeks, then fixing, staining, and quantifying colonies.

  • BrdU Incorporation: Though not explicitly mentioned in the provided search results, bromodeoxyuridine (BrdU) incorporation assays are valuable for directly measuring DNA synthesis rates, providing insight into cell cycle progression.

  • Cell Cycle Analysis: Flow cytometry-based cell cycle analysis using propidium iodide staining can determine if PAQR3 affects specific cell cycle phases, helping elucidate mechanisms of proliferation inhibition.

  • In Vivo Tumor Growth: Xenograft models provide the most physiologically relevant assessment of proliferation effects. In nude mice, PAQR3 overexpression in implanted PC3 cells significantly reduced tumor growth parameters (size, weight, volume), while PAQR3 knockdown promoted tumor growth .

For optimal experimental design, researchers should:

The combination of these assays provides robust evidence for PAQR3's antiproliferative effects in cancer cells and offers insights into potential therapeutic applications .

How can researchers assess PAQR3's impact on signaling pathways?

Researchers can employ multiple complementary approaches to assess PAQR3's impact on key signaling pathways:

  • Western Blotting for Phosphorylated Proteins:

    • ERK Pathway Assessment: Measure levels of phosphorylated ERK1/2 (p-ERK) following serum stimulation in cells with manipulated PAQR3 expression. In prostate cancer cells, PAQR3 overexpression robustly inhibits serum-induced ERK phosphorylation, while PAQR3 knockdown enhances it .

    • AKT Pathway Assessment: Quantify phosphorylated AKT (p-AKT) levels, particularly at Ser473 and Thr308 residues. PAQR3 overexpression in PC3 and DU145 cells significantly reduces AKT phosphorylation in response to serum, while knockdown increases it .

    • Total Protein Controls: Always measure total ERK and AKT protein levels alongside phosphorylated forms to calculate activation ratios.

  • Co-Immunoprecipitation Assays:

    • Assess physical interactions between PAQR3 and signaling components such as Raf-1 .

    • Determine if PAQR3 manipulation affects interactions between other signaling molecules in the pathway.

  • Subcellular Localization Studies:

    • Use immunofluorescence microscopy to visualize the localization of signaling components (e.g., Raf-1) in relation to Golgi markers in cells with varying PAQR3 expression.

    • Confirm PAQR3's ability to sequester Raf-1 to the Golgi apparatus .

  • Reporter Gene Assays:

    • Utilize pathway-specific luciferase reporters to quantify transcriptional output of ERK or AKT signaling.

    • Compare reporter activity between control cells and those with altered PAQR3 expression.

  • Pathway Inhibitor Studies:

    • Use selective inhibitors of MEK (e.g., U0126) or PI3K (e.g., LY294002) in combination with PAQR3 manipulation to determine pathway specificity.

    • Assess whether inhibitor treatment can rescue or mimics effects of PAQR3 overexpression.

When designing these experiments, researchers should consider:

  • Timing of serum stimulation (typically 15-30 minutes for acute signaling responses)

  • Cell density and serum starvation conditions

  • Inclusion of positive controls (e.g., EGF stimulation)

  • Dose-response relationships

  • Validation across multiple cell lines

These methodologies collectively provide a comprehensive assessment of how PAQR3 regulates critical oncogenic signaling pathways and offer insights into its tumor-suppressive mechanisms .

What approaches are used to evaluate PAQR3's effects on EMT?

Researchers employ multiple complementary approaches to comprehensively evaluate PAQR3's effects on epithelial-mesenchymal transition (EMT):

  • Protein Expression Analysis of EMT Markers:

    • Western Blotting: Quantify expression levels of epithelial markers (E-cadherin, ZO-1) and mesenchymal markers (vimentin) in cells with manipulated PAQR3 expression. In PC3 prostate cancer cells, PAQR3 overexpression increases E-cadherin and ZO-1 while decreasing vimentin, whereas PAQR3 knockdown produces the opposite effects .

    • Immunofluorescence Microscopy: Visualize subcellular localization and expression patterns of EMT markers, particularly at cell-cell junctions for epithelial markers.

  • Transcriptional Regulation Assessment:

    • qRT-PCR: Measure mRNA levels of EMT markers and EMT-regulating transcription factors (Snail, Slug, ZEB1/2, Twist1) in response to PAQR3 manipulation.

    • ChIP Assays: Determine if PAQR3 affects binding of transcription factors to EMT gene promoters.

    • Reporter Assays: Utilize promoter-luciferase constructs for EMT genes to assess transcriptional effects.

  • Functional Assays for EMT Phenotypes:

    • Cell Migration Assays: Use wound-healing and transwell assays to evaluate migratory capacity, a key functional outcome of EMT. PAQR3 overexpression reduces migration of PC3 and DU145 cells, while PAQR3 knockdown enhances it .

    • Cell Invasion Assays: Assess invasive capacity using Matrigel-coated transwell chambers.

    • Cell Morphology Analysis: Document and quantify changes in cell shape and intercellular contacts.

  • Molecular Interaction Studies:

    • Co-Immunoprecipitation: Investigate physical interactions between PAQR3 and EMT regulators such as Twist1 .

    • Ubiquitination Assays: Assess PAQR3's effect on ubiquitination and degradation of EMT transcription factors .

  • In Vivo Assessment:

    • Immunohistochemistry: Analyze EMT marker expression in xenograft tumors derived from cells with altered PAQR3 expression.

    • Metastasis Models: Evaluate effects on metastatic potential in orthotopic injection models.

Researchers should consider several factors when designing these experiments:

These methodologies collectively provide a comprehensive assessment of how PAQR3 regulates the EMT process in cancer cells, offering insights into its potential role in controlling tumor invasion and metastasis .

How should researchers interpret contradictory findings about PAQR3 function?

When encountering contradictory findings regarding PAQR3 function across different studies, researchers should employ a systematic approach to interpretation:

  • Evaluate Experimental Context:

    • Cell Type Specificity: PAQR3 may exert different effects in different cell types. For example, while PAQR3 consistently functions as a tumor suppressor in epithelial cancer cells, its role might differ in other cell types within the tumor microenvironment .

    • Genetic Background: Consider the mutational landscape of the models used. Cells with different driver mutations (p53, PTEN, RAS, etc.) may respond differently to PAQR3 manipulation.

    • Experimental Conditions: Differences in culture conditions, serum concentrations, cell density, and other experimental variables can influence outcomes.

  • Assess PAQR3 Expression Levels:

    • Overexpression Magnitude: Extreme overexpression might produce non-physiological effects.

    • Knockdown Efficiency: Partial vs. complete knockdown may yield different phenotypes.

    • Expression Verification Methods: Confirm if contradictory studies used comparable methods to verify PAQR3 expression levels.

  • Consider Pathway Cross-talk:

    • PAQR3 simultaneously affects multiple signaling pathways (Ras/Raf/MEK/ERK, PI3K/AKT) . The dominant pathway affected may vary between experimental systems, leading to different outcomes.

    • Evaluate the activation status of these pathways in the contradictory studies.

  • Analyze Temporal Dynamics:

    • Short-term vs. long-term effects of PAQR3 manipulation may differ due to compensatory mechanisms.

    • Consider whether acute or chronic PAQR3 alterations were studied.

  • Reconciliation Strategies:

    • Meta-analysis Approach: When possible, perform quantitative meta-analyses of multiple studies to identify patterns and sources of heterogeneity.

    • Validation Experiments: Design experiments specifically addressing contradictions, incorporating controls that account for identified variables.

    • Combinatorial Approaches: Use multiple methodologies (in vitro, in vivo, different assays) to build a more complete picture.

  • Biological Relevance Assessment:

    • Evaluate how findings align with PAQR3 expression patterns in human cancers (generally downregulated) .

    • Consider the evolutionary conservation of PAQR3 functions across species.

    • Assess consistency with known tumor biology principles.

By systematically evaluating these factors, researchers can better interpret contradictory findings, identify the most likely biological roles of PAQR3, and design experiments that address unresolved questions in the field.

What are the best approaches for analyzing PAQR3 expression data in clinical samples?

  • Sample Collection and Processing Considerations:

    • Tissue Preservation: Fresh-frozen tissues generally provide more reliable RNA and protein data than formalin-fixed paraffin-embedded (FFPE) samples.

    • Microdissection: Consider using laser capture microdissection to isolate specific cell populations, as PAQR3 expression may vary between tumor cells and stromal components.

    • Matched Samples: Whenever possible, analyze matched tumor and adjacent normal tissues from the same patients to control for individual variation.

  • Expression Analysis Methods:

    • qRT-PCR: For targeted analysis of PAQR3 mRNA, with careful selection of reference genes stable in the tissue type.

    • RNA-Seq: For genome-wide expression analysis, enabling correlation of PAQR3 with other genes.

    • Immunohistochemistry (IHC): For protein-level analysis and spatial distribution of PAQR3 within tissue architecture.

    • Western Blotting: For quantitative protein analysis when sufficient material is available.

  • Statistical Analysis Approaches:

    • Normalization Methods: Apply appropriate normalization strategies for the specific platform used (e.g., RPKM/FPKM/TPM for RNA-Seq data).

    • Differential Expression Analysis: Use methods like DESeq2 or limma for RNA-Seq data, or paired t-tests for matched samples in qRT-PCR data.

    • Multiple Testing Correction: Apply methods like Benjamini-Hochberg when performing multiple comparisons.

    • Power Analysis: Ensure sufficient sample size to detect expected effect sizes.

  • Integration with Clinical Data:

    • Survival Analysis: Use Kaplan-Meier and Cox proportional hazards models to correlate PAQR3 expression with patient outcomes.

    • Multivariate Analysis: Include relevant clinicopathological variables (stage, grade, age, etc.) to identify independent prognostic value.

    • Subgroup Analysis: Stratify analyses by molecular subtypes, treatment regimens, or other relevant categories.

  • Validation Strategies:

    • Independent Cohorts: Validate findings in separate patient cohorts.

    • Public Databases: Utilize public repositories like TCGA, which has shown significantly lower PAQR3 expression in prostate cancers compared to normal tissues .

    • Multi-platform Confirmation: When possible, validate findings using different techniques (e.g., confirm RNA-Seq results with qRT-PCR).

  • Biological Context Integration:

    • Pathway Analysis: Correlate PAQR3 expression with known pathway members (Ras/Raf/MEK/ERK, PI3K/AKT) .

    • EMT Marker Correlation: Analyze relationships between PAQR3 and EMT markers (E-cadherin, ZO-1, vimentin) .

    • Co-expression Networks: Identify genes co-regulated with PAQR3 to gain insights into biological context.

By implementing these comprehensive approaches, researchers can generate robust and clinically relevant data on PAQR3 expression in patient samples, potentially identifying its value as a biomarker or therapeutic target in cancer.

How can researchers quantify and statistically analyze PAQR3's effects on xenograft tumor growth?

Quantifying and statistically analyzing PAQR3's effects on xenograft tumor growth requires rigorous experimental design and appropriate analytical methods:

  • Experimental Design Considerations:

    • Sample Size Determination: Conduct power analysis before experiments to determine appropriate animal numbers (typically 8-10 mice per group).

    • Randomization: Randomly assign animals to experimental groups to avoid selection bias.

    • Blinding: Ensure investigators measuring tumors are blinded to experimental conditions.

    • Controls: Include appropriate controls (vector-only for overexpression studies, non-targeting shRNA for knockdown studies) .

  • Growth Parameters to Measure:

    • Tumor Volume: Measure using calipers at regular intervals (typically 2-3 times weekly), calculating volume using the formula V = (length × width²)/2 .

    • Tumor Weight: Determine at experimental endpoint after tumor excision .

    • Tumor Size: Document through photography with scale bars .

    • Growth Rate: Calculate as the slope of tumor volume over time.

    • Time to Reach Critical Size: Measure time required to reach a predetermined volume.

  • Advanced Measurements:

    • Proliferation Markers: Quantify Ki-67 or PCNA staining in tumor sections.

    • Apoptosis Assessment: Measure TUNEL staining or cleaved caspase-3.

    • Signaling Pathway Activation: Analyze phospho-ERK and phospho-AKT levels in tumor lysates .

    • EMT Marker Expression: Quantify epithelial and mesenchymal markers in tumor sections .

  • Statistical Analysis Methods:

    • Growth Curve Analysis: Use repeated measures ANOVA or mixed-effects models to analyze tumor volume over time.

    • Endpoint Comparisons: Apply t-tests or ANOVA with appropriate post-hoc tests for tumor weight and final volume comparisons.

    • Non-parametric Alternatives: Use Mann-Whitney or Kruskal-Wallis tests if data doesn't meet normality assumptions.

    • Survival Analysis: If using time-to-event endpoints, employ Kaplan-Meier curves and log-rank tests.

  • Data Visualization Approaches:

    • Growth Curves: Plot mean tumor volume (± SEM) against time.

    • Box-and-Whisker Plots: Display distribution of tumor weights.

    • Scatter Plots: Show individual data points with means/medians for transparency.

    • Correlation Plots: Relate tumor parameters to measured molecular markers.

  • Reporting Standards:

    • Effect Sizes: Report not only p-values but also effect sizes with confidence intervals.

    • Individual Data Points: Present individual animal data when possible, not just group averages.

    • Complete Methodological Details: Include all parameters that could affect outcomes.

    • ARRIVE Guidelines: Follow ARRIVE guidelines for reporting animal research.

Based on the search results, PAQR3 overexpression significantly reduced tumor growth parameters in PC3 xenografts, while PAQR3 knockdown enhanced them, demonstrating a dose-dependent relationship between PAQR3 levels and tumor growth . These findings provide strong evidence for PAQR3's tumor-suppressive activity in vivo, complementing in vitro observations of its antiproliferative effects.

What are the next key questions to address regarding PAQR3's role in cancer biology?

Several critical questions remain to be addressed to fully understand PAQR3's role in cancer biology and develop potential therapeutic applications:

  • Tissue-Specific Functions and Mechanisms:

    • How does PAQR3 function differ across various cancer types beyond prostate cancer?

    • Are there tissue-specific molecular partners or regulatory mechanisms that modulate PAQR3 activity?

    • What explains the consistent downregulation of PAQR3 across multiple cancer types ?

  • Regulation of PAQR3 Expression:

    • What transcriptional and epigenetic mechanisms control PAQR3 expression in normal and cancer cells?

    • Are there specific microRNAs that regulate PAQR3 mRNA stability or translation?

    • How do oncogenic signaling pathways feedback to regulate PAQR3 levels?

  • Interaction with Androgen Signaling:

    • Does PAQR3 interact with androgen receptor signaling pathways in prostate cancer?

    • Could PAQR3 modulation affect response to androgen deprivation therapy or development of castration resistance ?

    • Is there cross-talk between PAQR3 and other steroid hormone receptors?

  • Role in Tumor Microenvironment:

    • How does PAQR3 in cancer cells affect the tumor microenvironment composition?

    • Does PAQR3 influence angiogenesis, immune cell infiltration, or stromal reactions?

    • Could stromal PAQR3 expression contribute to tumor progression?

  • Metastasis Regulation:

    • What is the precise role of PAQR3 in controlling metastatic spread beyond its effects on EMT and cell migration ?

    • Does PAQR3 affect specific steps in the metastatic cascade (intravasation, survival in circulation, extravasation, colonization)?

    • Are there organ-specific effects of PAQR3 on metastatic tropism?

  • Therapeutic Applications:

    • Can PAQR3 expression or activity be pharmacologically enhanced as a therapeutic strategy?

    • Would PAQR3-based therapy be effective in combination with conventional treatments?

    • Could PAQR3 expression levels serve as biomarkers for treatment response?

  • Structure-Function Relationships:

    • Which domains of PAQR3 are essential for its tumor suppressive functions?

    • How does the seven-transmembrane structure influence its activity?

    • Can structure-based drug design target PAQR3 or its interactions?

  • Role in Cancer Stem Cells:

    • Does PAQR3 regulate cancer stem cell properties?

    • Could targeting PAQR3 affect tumor initiation capacity or treatment resistance?

Addressing these questions will require innovative experimental approaches combining molecular, cellular, and in vivo techniques. The answers will deepen our understanding of PAQR3 biology and potentially open new avenues for cancer diagnosis and treatment, particularly in prostate cancer where PAQR3 has demonstrated significant tumor suppressive activity .

What methodological advances are needed to better study PAQR3 function?

Advancing our understanding of PAQR3 function requires several methodological innovations and improvements:

  • Improved Structural Biology Approaches:

    • Cryo-EM or X-ray Crystallography: Determine the three-dimensional structure of PAQR3, particularly challenging due to its seven transmembrane domains and Golgi localization .

    • Structure-Function Analysis: Develop systematic mutation libraries to map functional domains of PAQR3.

    • Protein-Protein Interaction Mapping: Identify the complete interactome of PAQR3 within the Golgi membrane environment.

  • Advanced Genetic Models:

    • Conditional Knockout Models: Generate tissue-specific and inducible PAQR3 knockout mice to study its role in specific cancer types.

    • Knock-in Models: Create animals with tagged PAQR3 for in vivo tracking without disrupting function.

    • Humanized Models: Develop mouse models expressing human PAQR3 variants identified in cancer patients.

  • High-Resolution Imaging Techniques:

    • Super-Resolution Microscopy: Visualize PAQR3 distribution and dynamics within the Golgi apparatus at nanometer resolution.

    • Live-Cell Imaging: Track PAQR3 trafficking and interactions in real-time.

    • Correlative Light and Electron Microscopy (CLEM): Combine fluorescence and electron microscopy to study PAQR3 in its native membrane environment.

  • Systems Biology Approaches:

    • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data to understand PAQR3's global effects.

    • Network Analysis: Map PAQR3's position in cellular signaling networks beyond the currently known Ras/Raf/MEK/ERK and PI3K/AKT pathways .

    • Mathematical Modeling: Develop quantitative models of how PAQR3 levels affect signaling dynamics.

  • Translational Research Tools:

    • Patient-Derived Organoids: Test PAQR3 function in 3D cultures derived directly from patient tumors.

    • High-Throughput Screening: Develop assays to identify compounds that modulate PAQR3 expression or function.

    • Biomarker Development: Create robust assays for PAQR3 quantification in clinical samples.

  • Gene Editing Technologies:

    • CRISPR-Cas9 Applications: Generate clean PAQR3 knockouts or knock-ins in diverse cell types.

    • Base Editing: Introduce specific point mutations to study PAQR3 variants.

    • CRISPRi/CRISPRa: Develop tools for controlled silencing or activation of endogenous PAQR3.

  • In Vivo Metastasis Models:

    • Orthotopic Models: Study PAQR3's role in metastasis using models that better recapitulate natural metastatic routes.

    • Lineage Tracing: Track the fate of PAQR3-manipulated cells during the metastatic process.

    • Intravital Imaging: Visualize PAQR3-expressing cells in living animals during tumor progression.

  • Pharmacological Tools:

    • Specific Inhibitors/Activators: Develop compounds that specifically modulate PAQR3 function.

    • Cell-Penetrating Peptides: Design peptides mimicking PAQR3 functional domains.

    • Targeted Delivery Systems: Create methods to specifically deliver PAQR3-modulating agents to tumor cells.

These methodological advances would significantly enhance our ability to study PAQR3's complex biology and potentially translate findings to clinical applications for prostate cancer and other malignancies where PAQR3 has demonstrated tumor suppressive activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.