Recombinant Human Progestin and adipoQ receptor family member 4 (PAQR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human PAQR4

Recombinant Human PAQR4 (Progestin and AdipoQ Receptor Family Member 4) is a full-length recombinant protein spanning amino acids 1–273. It belongs to the PAQR family, a group of membrane receptors involved in metabolic regulation and cancer biology . This recombinant protein is engineered for research purposes, with applications in studying adipose tissue function, ceramide metabolism, and cancer mechanisms.

Biological Functions

PAQR4 regulates adipose tissue function and ceramide metabolism:

  • Ceramide Regulation: Maintains adipose tissue health by stabilizing ceramide synthases (CERS2/CERS5) and modulating ceramide levels .

  • Adipose Tissue Remodeling: Upregulated in obese subcutaneous white adipose tissue (sWAT), inversely correlated with adiponectin (ADIPOQ) and PPARγ expression .

Cancer-Related Roles

PAQR4 exhibits oncogenic properties across multiple cancers:

Pan-Cancer Analysis

Cancer TypePAQR4 ExpressionClinical CorrelationSources
NSCLCHigh in A549, H1299, H1650 cellsPoor prognosis, chemoresistance
Bladder Cancer (BLCA)Elevated in tissues and cell linesPromotes proliferation, migration, invasion
Renal Clear Cell Carcinoma (KIRC)Upregulated in cell linesEnhanced tumor growth, metastasis

Key Mechanisms:

  • Chemoresistance: PAQR4 stabilizes Nrf2 by disrupting Keap1-Nrf2 interaction, reducing cisplatin-induced apoptosis in NSCLC .

  • Immune Regulation: Linked to high tumor mutation burden (TMB) and microsatellite instability (MSI) in pan-cancer cohorts .

Non-Small Cell Lung Cancer (NSCLC)

  • PAQR4 Knockdown: Reduces tumor volume in xenograft models and enhances cisplatin sensitivity .

  • Nrf2 Pathway: PAQR4 binds Nrf2, blocking its degradation via Keap1-mediated ubiquitination .

Adipose Tissue and Metabolism

  • Obesity Models: Paqr4 deletion in mice reduces fat mass and improves metabolic health, suggesting PAQR4’s role in adipose tissue fibrosis .

Pan-Cancer Prognosis

  • High PAQR4 Expression correlates with advanced tumor stages, immune cell infiltration, and poor survival in BLCA, KIRC, and liver cancers .

Applications in Research

  • Cancer Therapy: Targeting PAQR4 may improve platinum-based chemotherapy efficacy in NSCLC .

  • Metabolic Diseases: PAQR4’s role in adipose remodeling positions it as a therapeutic candidate for obesity-related disorders .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAQR4; Progestin and adipoQ receptor family member 4; Progestin and adipoQ receptor family member IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PAQR4
Target Protein Sequence
MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALL GFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDM CGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQ AAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSH QIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies show that PAQR4 exhibits a tumorigenic effect in human breast cancers, possibly through modulating CDK4 protein degradation. (PMID: 29228296)[Link to PubMed]
Database Links

HGNC: 26386

OMIM: 614578

KEGG: hsa:124222

UniGene: Hs.351474

Protein Families
ADIPOR family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Relatively widely expressed in a range of tissues.

Q&A

What is PAQR4 and what are its fundamental characteristics?

PAQR4 (Progestin And AdipoQ Receptor Family Member 4) is a member of the progestin and adipoQ receptor family. It is encoded by the PAQR4 gene (Gene ID: 124222, OMIM: 614578, HGNC: 26386) in humans. The protein is characterized as a membrane-bound receptor with multiple transmembrane domains, similar to other members of the PAQR family .

Based on structural analysis and comparison with other PAQR family members, PAQR4 is predicted to be an integral component of the plasma membrane. The protein's functional domains include transmembrane regions that anchor it within the cell membrane, potentially facilitating its role in signal transduction pathways. While specific ligand interactions are still being investigated, the structural similarity to other PAQR family members suggests potential roles in steroid hormone signaling or adiponectin-mediated pathways.

How should researchers approach PAQR4 expression and purification for experimental studies?

When expressing and purifying recombinant Human PAQR4 for experimental studies, researchers should consider several methodological approaches:

  • Expression System Selection: Mammalian expression systems are generally preferred for human membrane proteins like PAQR4 to ensure proper folding and post-translational modifications. HEK293 or CHO cell lines are commonly used for this purpose.

  • Purification Strategy:

    • Utilize affinity tags (His, FLAG, etc.) for initial purification

    • Implement size exclusion chromatography to remove aggregates

    • Consider detergent screening to identify optimal solubilization conditions

  • Quality Control: Assess protein quality through:

    • SDS-PAGE and Western blotting for purity and identity verification

    • Circular dichroism to confirm secondary structure integrity

    • Functional binding assays to verify activity

  • Storage Considerations: Store purified protein at -80°C in small aliquots with cryoprotectants to minimize freeze-thaw cycles, as membrane proteins are particularly sensitive to denaturation .

It is important to note that recombinant proteins may have different sequences or tertiary structures compared to native proteins, potentially affecting experimental outcomes. Optimization of expression and purification protocols specifically for PAQR4 is essential for obtaining functional protein for downstream applications.

What detection methods are recommended for PAQR4 analysis in experimental systems?

Several detection methods can be employed for analyzing PAQR4 in experimental systems, each with specific advantages depending on research objectives:

MethodApplicationSensitivityConsiderations
ELISAQuantitative protein detectionHigh (< 0.188 ng/ml)Requires specific antibodies; optimal for 0.313-20 ng/ml range
Western BlotProtein expression and size verificationModerateSemi-quantitative; good for comparative analysis
qRT-PCRGene expression analysisHighMeasures mRNA not protein; transcript-protein correlation needed
ImmunofluorescenceSubcellular localizationModerateProvides spatial information; requires specific antibodies
Mass SpectrometryProtein identification/modificationVery HighComplex sample preparation; expensive equipment

For ELISA-based detection of PAQR4, researchers should consider the following methodological aspects:

  • Use sandwich ELISA for higher specificity and sensitivity

  • Optimize sample preparation (tissue homogenates, cell lysates)

  • Ensure proper assay validation with positive and negative controls

  • Consider the detection range (0.313-20 ng/ml) when planning dilutions

It is crucial to validate detection methods with appropriate controls, particularly when studying native versus recombinant PAQR4, as differences in protein folding or post-translational modifications may affect antibody recognition or functional assays.

How does PAQR4 differ from other members of the PAQR family?

PAQR4 exhibits both similarities and differences when compared to other members of the PAQR family, such as PAQR6:

  • Structural Similarities:

    • Both PAQR4 and other family members like PAQR6 are integral membrane proteins

    • Share conserved transmembrane domains characteristic of the PAQR family

    • Likely adopt similar topology within the plasma membrane

  • Functional Distinctions:

    • While PAQR6 has been characterized as a plasma membrane progesterone receptor coupled to G proteins, PAQR4's precise signaling mechanisms remain less defined

    • PAQR6 appears to act through G(s)-mediated pathways and is involved in neurosteroid inhibition of apoptosis

    • PAQR4 may have distinct tissue distribution patterns and ligand specificities

  • Genetic Context:

    • PAQR4: Gene ID 124222, UniProt Q8N4S7

    • PAQR6: Gene ID 79957, UniProt Q6TCH4

    • Different chromosomal locations and potentially different regulatory elements

Understanding these distinctions is important for researchers designing experiments targeting PAQR4 specifically, as cross-reactivity with other PAQR family members could confound results. Experimental designs should incorporate appropriate controls to confirm specificity for PAQR4 versus other PAQR family members.

What are the optimal experimental design strategies for studying PAQR4 signaling pathways?

When designing experiments to investigate PAQR4 signaling pathways, researchers should consider implementing quasi-experimental designs (QEDs) that balance internal and external validity. Based on methodological best practices:

  • Pre-Post Designs with Non-Equivalent Control Groups:

    • Implement when studying PAQR4 knockdown or overexpression effects

    • Select control groups that match experimental groups on relevant covariates to minimize selection bias

    • Address potential history bias by controlling for concurrent cellular events

    • Consider using multiple time points to establish temporal relationships

  • Interrupted Time Series Approaches:

    • Valuable for studying dynamic responses in PAQR4 signaling pathways

    • Collect multiple data points before and after intervention

    • Allow detection of both immediate and delayed effects of PAQR4 modulation

    • Control for secular trends unrelated to the intervention

  • Stepped Wedge Designs:

    • Useful for implementing PAQR4 manipulation across multiple cell lines or tissues

    • Stagger intervention implementation across experimental units

    • Particularly valuable when ethical or logistical constraints prevent simultaneous implementation

    • Enhance statistical power through both between and within-group comparisons

To maximize internal validity when studying PAQR4 signaling, researchers should implement the following strategies:

  • Use multiple complementary approaches (genetic manipulation, pharmacological inhibition)

  • Include appropriate positive and negative controls

  • Verify results across different cell types or model systems

  • Implement blinding procedures during data collection and analysis

  • Preregister experimental protocols to minimize bias

How can researchers address the challenges of data interpretation in PAQR4 functional studies?

Researchers face several challenges when interpreting data from PAQR4 functional studies. Methodological approaches to address these challenges include:

  • Addressing Contradictory Results:

    • Implement methodological triangulation by using multiple experimental approaches

    • Consider tissue-specific or context-dependent functions of PAQR4

    • Systematically evaluate differences in experimental conditions that may explain contradictions

    • Perform meta-analysis of available data when sufficient studies exist

  • Establishing Causality vs. Correlation:

    • Utilize genetic approaches (CRISPR/Cas9, siRNA) to establish direct relationships

    • Implement rescue experiments to confirm specificity of observed effects

    • Design dose-response studies to establish quantitative relationships

    • Apply causal inference statistical methods appropriate for biological systems

  • Distinguishing PAQR4-Specific Effects:

    • Include parallel experiments with other PAQR family members

    • Utilize multiple targeting approaches with different mechanisms

    • Confirm specificity through complementary detection methods

    • Consider potential compensatory mechanisms within the PAQR family

  • Data Integration Strategies:

    • Combine transcriptomic, proteomic, and functional data

    • Apply systems biology approaches to model PAQR4 within signaling networks

    • Utilize computational approaches to predict and test PAQR4 interactions

    • Consider evolutionary conservation of PAQR4 functions across species

When analyzing experimental results, researchers should employ robust statistical methods, including:

  • Appropriate sample size determination through power analysis

  • Correction for multiple comparisons when testing several hypotheses

  • Assessment of effect size rather than just statistical significance

  • Transparent reporting of all results, including negative findings

What are the methodological considerations for studying PAQR4-protein interactions?

Studying protein-protein interactions involving PAQR4 requires specialized approaches due to its membrane-embedded nature. Key methodological considerations include:

  • Selection of Interaction Detection Methods:

MethodAdvantagesLimitationsBest Application
Co-immunoprecipitationDetects native interactionsRequires good antibodies; may disrupt weak interactionsInitial screening for strong interactors
Proximity Ligation AssayVisualizes interactions in situRequires specific antibodies; semi-quantitativeConfirming interactions in native context
FRET/BRETReal-time dynamics; live cellsRequires protein tagging; potential tag interferenceStudying dynamic interaction kinetics
Yeast Two-HybridHigh-throughput screeningHigh false positive rate; not ideal for membrane proteinsInitial discovery with modified protocols
Mass SpectrometryUnbiased; identifies complexesComplex sample preparation; may miss transient interactionsGlobal interactome analysis
  • Membrane Protein-Specific Considerations:

    • Optimize detergent conditions to maintain protein structure while allowing solubilization

    • Consider using membrane yeast two-hybrid or split-ubiquitin systems specifically designed for membrane proteins

    • Validate interactions in multiple systems (in vitro, cell culture, tissue samples)

    • Control for non-specific hydrophobic interactions common with membrane proteins

  • Data Validation Strategies:

    • Confirm interactions bidirectionally (e.g., IP-A pulls down B, IP-B pulls down A)

    • Demonstrate functional significance through mutation of interaction interfaces

    • Show co-localization through complementary methods (microscopy, fractionation)

    • Establish biological relevance through functional assays after disrupting interactions

  • Computational Approaches:

    • Utilize structural prediction to identify potential interaction domains

    • Apply molecular docking to test hypothetical interactions

    • Implement network analysis to place interactions in broader signaling context

    • Develop testable hypotheses based on predicted interactions

When reporting PAQR4 interaction studies, researchers should clearly describe all experimental conditions, including detergent types and concentrations, buffer compositions, and control experiments conducted to verify specificity.

How should researchers approach the study of PAQR4 in different tissue contexts?

Studying PAQR4 across different tissue contexts requires careful experimental planning to account for tissue-specific factors that may influence its function:

  • Tissue-Specific Expression Analysis:

    • Implement comparative transcriptomics and proteomics across tissues

    • Validate expression differences through multiple methodologies (qPCR, Western blot, immunohistochemistry)

    • Consider analyzing single-cell data to identify cell type-specific expression patterns

    • Examine developmental regulation in different tissues

  • Functional Comparison Approaches:

    • Design parallel experiments in multiple tissue models

    • Utilize tissue-specific conditional knockout models

    • Implement ex vivo tissue culture systems to maintain native architecture

    • Consider organoid models for three-dimensional tissue context

  • Experimental Design Considerations:

    • Apply pre-post designs with non-equivalent control groups when comparing PAQR4 function across tissues

    • Implement stepped wedge designs when studying multiple tissue types sequentially

    • Control for tissue-specific confounding variables in experimental design

    • Consider using interrupted time series approaches to study dynamic responses in different tissues

  • Data Integration and Analysis:

    • Develop tissue-specific reference datasets for baseline comparison

    • Apply multivariate analysis to identify tissue-dependent versus tissue-independent functions

    • Consider hierarchical modeling approaches to account for tissue-specific nested factors

    • Implement meta-analysis techniques to synthesize findings across tissue types

When comparing PAQR4 function across different tissues, researchers should pay particular attention to:

  • Tissue-specific post-translational modifications

  • Differences in interaction partners and signaling networks

  • Variation in membrane composition affecting receptor function

  • Potential differences in ligand availability or concentration

What quality control measures are essential when working with recombinant PAQR4?

Ensuring the quality of recombinant PAQR4 preparations is critical for obtaining reliable and reproducible research results. Essential quality control measures include:

  • Structural and Physical Characterization:

    • Verify protein size and purity through SDS-PAGE and Western blotting

    • Confirm protein identity through mass spectrometry

    • Assess secondary structure integrity via circular dichroism

    • Evaluate aggregation state through size exclusion chromatography or dynamic light scattering

  • Functional Validation:

    • Develop binding assays for known or predicted ligands

    • Verify membrane integration in reconstituted systems

    • Establish functional reporter assays for downstream signaling

    • Compare activity to native protein when possible

  • Stability Assessment:

    • Monitor stability under various storage conditions

    • Establish acceptance criteria for continued use (e.g., <5% activity loss)

    • Implement regular quality checks for long-term storage

    • Document batch-to-batch variation and establish consistency parameters

  • Experimental Controls:

    • Include inactive mutants as negative controls

    • Utilize other PAQR family members for selectivity assessment

    • Implement positive controls with known activity profiles

    • Consider using commercially available standards when possible

Quality ParameterMethodAcceptance CriteriaFrequency
PuritySDS-PAGE/HPLC>95% purityEach batch
IdentityMass SpectrometryCorrect MW ±0.1%Each new preparation
ActivityFunctional Assay>80% of reference standardEach batch
StabilityActivity Retention<5% loss over storage periodMonthly or before use
AggregationDLS/SEC<10% high molecular weight speciesEach batch

Researchers should note that recombinant PAQR4 may differ from native protein in several aspects, including post-translational modifications, folding, and tertiary structure. These differences may affect experimental outcomes and should be considered when interpreting results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.