Recombinant Human Prokineticin receptor 1 (PROKR1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

PROKR1 mediates diverse biological processes through its interaction with prokineticins. Below are key pathways and physiological roles:

Angiogenesis and Endothelial Function

PROKR1 promotes angiogenesis by regulating endothelial cell (EC) survival, proliferation, and migration. In endothelial-specific knockout (ec-PKR1−/−) mice, capillary formation is impaired, leading to:

  • Reduced transendothelial insulin uptake in heart, kidney, and adipose tissues.

  • Defective endothelial nitric oxide synthase (eNOS) activation and endothelium-dependent vasodilation .

Reproductive and Endometrial Signaling

PROKR1 is upregulated in first-trimester decidua and regulates implantation-related genes:

GeneFunctionMechanism
COX-2Prostaglandin synthesisGq-PLC-βcSrc-EGFR-MAPK/ERK pathway
LIF, IL-11Implantation and immune modulationERK1/2 activation

Metabolic Regulation and Muscle Development

PROKR1 enhances oxidative muscle fiber composition via the PROKR1–CREB–NR4A2 axis:

  1. Activation: PROK2 binding to PROKR1 triggers Gs-mediated cAMP production and CREB phosphorylation.

  2. Gene Regulation: Phosphorylated CREB binds to the NR4A2 promoter, upregulating mitochondrial biogenesis factors (PGC1α, TFAM) and oxidative markers (Myh7) .

  3. Metabolic Impact: Prokr1-deficient mice exhibit:

    • Reduced lean mass and impaired glucose tolerance.

    • Decreased energy expenditure and exercise performance .

Hirschsprung Disease (HSCR)

PROKR1 variants are linked to HSCR susceptibility:

VariantGeneEffectSource
Missense mutationsPROKR1Impaired enteric neural crest cell signaling

Recurrent Miscarriage and Reproductive Disorders

Sequence variants in PROKR1 may disrupt follicular development and early pregnancy signaling .

Metabolic Disorders

Endothelial PROKR1 loss leads to:

PhenotypeMechanismOutcome
Insulin resistanceImpaired transendothelial insulin uptakeHyperinsulinemia, lipodystrophy
Cardiac dysfunctionMyocardial fibrosis, apoptosisDiastolic dysfunction

Recombinant PROKR1 Clones

Available from commercial sources (e.g., GenScript) for cloning and expression studies:

Product TypeApplicationPrice Range
cDNA ORF clonesGene expression, mutagenesis$99–$500+
Stable cell linesSignaling pathway studiesCustom pricing

Pharmacological Modulators

CompoundFunctionApplicationSource
PKRA 7AntagonistAnti-tumor research
PROK2 agonistsPathway activationMuscle and metabolic studies

Therapeutic Potential

  1. Muscular Diseases: PROKR1 activation enhances oxidative fiber composition, offering potential for treating muscle atrophy .

  2. Metabolic Disorders: Targeting endothelial PROKR1 may improve insulin sensitivity and prevent lipodystrophy .

  3. Angiogenic Therapies: PROKR1 agonists could promote capillary formation in ischemic tissues.

Table 1: PROKR1 Signaling Pathways

PathwayDownstream TargetsBiological Outcome
Gq-PLC-MAPK/ERKCOX-2, IL-6, IL-8Inflammation, implantation
Gs-cAMP-CREB-NR4A2PGC1α, TFAM, Myh7Oxidative muscle fibers

Table 2: PROKR1 vs. PROKR2

FeaturePROKR1PROKR2
Ligand PreferencePROK1 > PROK2PROK2 > PROK1
Tissue ExpressionEndothelia, muscle, endometriumHypothalamus, pituitary
Disease AssociationHSCR, miscarriageKallmann syndrome, cancer

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
PROKR1; GPR73; PKR1; Prokineticin receptor 1; PK-R1; G-protein coupled receptor 73; G-protein coupled receptor ZAQ; GPR73a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFA AKIVIGMALVGIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEM DYYVVRQLSWEHGHVLCTSVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAT GLIALVWTVSILIAIPSAYFTTETVLVIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGIE FVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPF YGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTVKYFKKIMLLH WKASYNGGKSSADLDLKTIGMPATEEVDCIRLK
Uniprot No.

Target Background

Function

Prokineticin receptor 1 (PROKR1) is a receptor for prokineticin 1, exclusively coupled to the Gq subclass of heterotrimeric G proteins. Activation triggers calcium mobilization, phosphoinositide turnover stimulation, and p44/p42 mitogen-activated protein kinase activation. It may play a role in early pregnancy.

Gene References Into Functions
  1. Association between PKR2 rs6053283 polymorphism and recurrent pregnancy loss (RPL) (P=0.003) was observed in a Chinese Han population study, while no association was found between PKR1 rs4627609 and RPL (P=0.929). PMID: 26984842
  2. Prokineticins (PROK1 and PROK2) and their receptors (PROKR1 and PROKR2) are key regulators of ovarian, uterine, placental, and testicular physiological functions. [REVIEW] PMID: 26574895
  3. EG-VEGF and its receptor PKR1 may contribute to adrenocortical tumor pathogenesis and serve as prognostic markers. PMID: 26475302
  4. PROK1 and PROKR1 expression was significantly higher in mid-gestation (17-20 weeks) ovaries compared to earlier gestational stages (8-11 and 14-16 weeks). PMID: 26192875
  5. This study highlights the clinical relevance of the EG-VEGF system in early human pregnancy and demonstrates gene-gene interactions between EG-VEGF and PROKR variants. PMID: 25064403
  6. The I397V variant is associated with a lower risk of recurrent miscarriage. PMID: 23687280
  7. hCG increases EG-VEGF, PROKR1, and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, indicating a novel regulatory role for hCG. PMID: 22138749
  8. Studies suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2. PMID: 22132188
  9. Sequence variants in PROKR1, PROK1, and PROKR2 genes, sometimes in combination with RET or GDNF mutations, are implicated as susceptibility genes for Hirschsprung's disease (HSCR). PMID: 21858136
  10. PKR1 levels are not reduced in preeclampsia. PMID: 21876489
  11. Smoking may affect human fallopian tubes through nAChRalpha-7, increasing tubal PROKR1 and potentially leading to ectopic pregnancy. PMID: 20864676
  12. PROK1 and PKR1 expression was observed in multiple myeloma (MM) cells and cell lines. PMID: 20795791
  13. Two tag SNPs of PKR1 (rs4627609, rs6731838) showed significant association with idiopathic recurrent pregnancy loss. PMID: 20847187
  14. PROK1-PROKR1 interaction induces IL-11 expression in PROKR1 Ishikawa cells and first-trimester decidua. PMID: 19801577
  15. Coronary endothelial cell function is influenced by PKR1 and PKR2 expression levels and their distinct signaling pathways. PMID: 20023120
  16. Molecular cloning, amino acid sequence, and expression in various human tissues are described. PMID: 12427552
  17. The PKs and their receptors play a paracrine role in endometrial vascular function. PMID: 15126578
  18. Prokineticins 1 and 2 and their receptors are expressed in human prostate tissue, with increased levels associated with prostate malignancy. PMID: 16763065
  19. Elevated PROK1 and PROKR1 expression in human decidua during early pregnancy, and their interaction regulates the expression of multiple implantation-related genes. PMID: 18339712
Database Links

HGNC: 4524

OMIM: 607122

KEGG: hsa:10887

STRING: 9606.ENSP00000303775

UniGene: Hs.683430

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Localizes to glandular epithelium, stroma and vascular endothelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the stomach, throughout the small int

Q&A

What expression systems are optimal for producing functional recombinant human PROKR1 for ligand-binding assays?

Recombinant PROKR1 requires proper post-translational modifications for ligand-binding functionality. Mammalian systems (e.g., HEK293, CHO-K1) are preferred over bacterial systems due to their ability to support GPCR folding and glycosylation . For kinetic binding assays, transient transfection with a C-terminal tag (e.g., HA or FLAG) enables immunoprecipitation validation. A 2023 study demonstrated that HEK293 cells expressing PROKR1 showed robust cAMP response element-binding protein (CREB) phosphorylation upon ligand activation, confirming functional coupling to Gs proteins .

Key Parameters for Expression Optimization:

ParameterRecommendationSource
Host Cell LineHEK293 (for high transfection efficiency)
Tag PositionC-terminal (minimizes receptor steric effects)
Validation AssayRadioligand binding (³⁵S-GTPγS) or CREB phosphorylation

How can researchers distinguish PROKR1-specific signaling from cross-talk with PROKR2 in vitro?

PROKR1 and PROKR2 share 85% sequence homology but exhibit ligand selectivity. Use pharmacological tools:

  • PROKR1-specific agonist: PK1-C (EC₅₀ = 1.2 nM for PROKR1 vs. >100 nM for PROKR2) .

  • PROKR2-specific antagonist: PC-7 (IC₅₀ = 5 nM for PROKR2; no effect on PROKR1) .
    Combine siRNA knockdown (e.g., siRNA-PROKR1 reduces oxidative fiber specification in myotubes by 60%, while siRNA-PROKR2 has no effect ).

What are validated methods to quantify PROKR1-mediated intracellular signaling in muscle cells?

PROKR1 activates Gs-coupled pathways, increasing cAMP and phosphorylated CREB (pCREB). Methodological steps:

  • Stimulation: Treat human myotubes with 10 nM PROK1 for 15 min .

  • Detection:

    • pCREB: Western blot (anti-pCREB Ser133; 1:1,000 dilution).

    • NR4A2 induction: qPCR (2^-ΔΔCt method; primers for NR4A2 vs. GAPDH) .

  • Functional readouts: Mitochondrial respiration (Seahorse XF Analyzer) shows 30% increase in OCR in PROKR1-activated myotubes .

How does tissue-specific PROKR1 signaling explain contradictory roles in neuronal survival versus muscle metabolism?

PROKR1 exhibits context-dependent signaling:

  • Muscle: Gs-cAMP-CREB-NR4A2 axis upregulates oxidative fiber genes (e.g., PGC-1α, COX4), enhancing mitochondrial biogenesis .

  • Neurons: PROKR1 activation reduces proliferation via p38 MAPK inhibition (50% decrease in BrdU incorporation at 1 nM PROK1) .

Tissue-Specific Signaling Outcomes:

TissuePathway ActivatedFunctional OutcomeSource
Skeletal MuscleGs-cAMP-CREB-NR4A2↑Oxidative fiber specification
NeuronsGq-PLCβ-p38 MAPK↓Proliferation, ↑apoptosis

Resolution of Data Contradictions: Tissue-specific G protein coupling (Gs in muscle vs. Gq in neurons) explains divergent phenotypes. Use conditional knockout models (e.g., Prokr1^flox/flox crossed with tissue-specific Cre lines) to isolate pathways .

What experimental strategies resolve discrepancies in PROKR1’s role in angiogenesis across cardiac versus reproductive tissues?

PROKR1 promotes angiogenesis in cardiac endothelial cells but not in luteal endothelial cells:

  • Cardiac: PROKR1 overexpression increases capillary tube formation by 2.5-fold via Akt phosphorylation, independent of VEGF .

  • Corpus Luteum: PROKR1 stabilizes existing vessels via Angiopoietin-1 secretion but does not induce new sprouting .

Methodological Recommendations:

  • 3D Matrigel Assay: Use tissue-specific endothelial cells (e.g., cardiac vs. ovarian).

  • Pathway Inhibition: Co-treat with Akt inhibitor MK-2206 (10 μM) to confirm PROKR1-Akt dependency in cardiac angiogenesis .

How can researchers model PROKR1’s dual role in cell survival (cardiac) versus apoptosis (neuronal) in vitro?

Adopt co-culture systems to isolate microenvironmental factors:

  • Cardiomyocyte Survival: H9c2 cells + PROKR1 agonist (10 nM PK1-C) → 40% reduction in H₂O₂-induced apoptosis via Akt-Bcl2 axis .

  • Neuronal Apoptosis: SH-SY5Y cells + PROKR1 siRNA → 25% increase in caspase-3 activity under serum-free conditions .

Key Controls:

  • Include PROKR1-negative cells (CRISPR knockout) to confirm receptor specificity.

  • Measure cross-talk with PROKR2 using selective antagonists .

What computational models predict PROKR1 ligand-binding dynamics for novel agonist design?

Molecular dynamics (MD) simulations of PROKR1 extracellular loops (ECL2-3) identify critical residues for ligand docking :

  • Residue D115: Hydrogen bonding with PROK1’s C-terminal amide group (ΔG = -9.2 kcal/mol).

  • Residue Y220: Hydrophobic interaction with PROK1’s β-hairpin .

In Silico Workflow:

  • Homology Modeling: Use bovine rhodopsin (PDB:1U19) as a template .

  • Docking: AutoDock Vina with PROK1 (PDB:2KS9).

  • Validation: Compare predicted ΔG with experimental IC₅₀ from radioligand displacement assays .

Methodological Best Practices

  • Data Reproducibility: Validate PROKR1 antibodies using knockout lysates (e.g., Prokr1^-/- mice show no bands at 45 kDa) .

  • Contradiction Analysis: Use pathway enrichment tools (Ingenuity IPA) to identify tissue-specific signaling nodes .

  • Ethical Reporting: Disclose PROKR1’s pleiotropic roles in grant applications to avoid oversimplification of therapeutic potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.