Recombinant Human Prokineticin receptor 2 (PROKR2)

Shipped with Ice Packs
In Stock

Description

Circadian Rhythm Regulation

  • PROKR2 mediates PK2 signaling in the SCN, synchronizing circadian outputs such as locomotor activity and body temperature .

  • PK2 expression oscillates diurnally, peaking during daylight in nocturnal rodents .

  • Prokr2 knockout mice exhibit fragmented activity rhythms and attenuated body temperature cycles, though SCN molecular clocks remain intact .

Reproductive Biology

  • PROKR2 guides GnRH neuron migration during embryogenesis. Mutations cause Kallmann syndrome (KS) or normosmic hypogonadotropic hypogonadism (nIHH) .

  • Over 20 PROKR2 mutations (e.g., R85C, V115M, R164Q) are linked to reproductive disorders, often with incomplete penetrance .

Neuroendocrine and Olfactory Functions

  • PROKR2 is critical for olfactory bulb development; loss results in anosmia and GnRH deficiency .

  • Non-reproductive phenotypes include sleep disturbances, epilepsy, and synkinesia in mutation carriers .

Genetic Mutations and Clinical Spectrum

A meta-analysis of PROKR2 variants reveals:

MutationPhenotypeFunctional ImpactReported Cases
R85CKS/nIHHImpaired Ca²⁺ mobilization, reduced receptor expression 6 families
V115MKS with reversalDisrupted MAPK signaling 3 cases
L173RSepto-optic dysplasiaLoss of ligand binding 1 case
R164QIsolated GH deficiencyReduced cAMP signaling 2 cases

Research Insights and Therapeutic Potential

  • Circadian Dysregulation: PK2/Prokr2 signaling is a target for sleep disorders. Mice lacking Prokr2 exhibit prolonged torpor .

  • Neurogenesis: PK2 acts as a chemoattractant for neuronal progenitors, suggesting roles in neurorepair .

  • Drug Development: Small-molecule agonists/antagonists of PROKR2 could treat infertility or circadian disorders, though none are clinically approved .

Limitations and Future Directions

  • Heterogeneity: Over 60% of PROKR2 mutation carriers exhibit oligogenic traits, complicating genotype-phenotype correlations .

  • Ligand-Receptor Specificity: PROKR2 binds both PK1 and PK2, but tissue-specific signaling outcomes remain unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for the specific delivery timeframe.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PROKR2; GPR73L1; PKR2; Prokineticin receptor 2; PK-R2; G-protein coupled receptor 73-like 1; G-protein coupled receptor I5E; GPR73b; GPRg2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK SSADLDLRTNGVPTTEEVDCIRLK
Uniprot No.

Target Background

Function
Prokineticin receptor 2 (PROKR2) functions as a receptor for prokineticin 2. It is exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation leads to calcium mobilization, stimulation of phosphoinositide turnover, and activation of p44/p42 mitogen-activated protein kinase.
Gene References Into Functions
  1. EG-VEGF and PROKR2 were highly expressed in colorectal primary lesions compared to positive controls. PROKR1 expression was lower and did not change in tumor specimens. PMID: 29226856
  2. The deletion contained 17 protein coding genes, including PROKR2 and BMP2, both of which are expressed during embryological development of the pituitary gland. PROKR2 mutations have been associated with hypopituitarism; however, a heterozygous deletion of this gene with hypopituitarism is a novel observation. PMID: 28586151
  3. PROKR2 genetic mutation plays a role in the pathogenesis of pituitary stalk interruption syndrome. PMID: 28453858
  4. A significant association between PKR2 rs6053283 polymorphism and Recurrent pregnancy loss (RPL) (P=0.003) was observed, whereas no association was found between PKR1 rs4627609 polymorphism and RPL (P=0.929) in the Chinese Han population. PMID: 26984842
  5. PROKR2 may play a role in susceptibility to pituitary stalk interruption syndrome. PMID: 26956854
  6. PROKR2 expression in human fetal ovary remained unchanged throughout gestation. PMID: 26192875
  7. PKR2 protomers form type II dimers involving TMs 4 and 5, with TM5 playing a role in modulating PKR2 function. PMID: 25449422
  8. PK2-induced PKR2 endocytosis is dependent on GRK2 and clathrin but not beta-arrestin. PMID: 24509228
  9. Wild-type PROKR2 activates different G-protein subtypes (Gq, Gs, and Gi/o) and recruits beta-arrestins. Examining the effects of 9 missense mutations on these two processes revealed that some mutations affected both or only one of them. PMID: 24830383
  10. Single PROKR2 missense allelic variants can either affect both cAMP and IP signaling pathways differently or selectively. PMID: 24276467
  11. The prokineticin (PK)1/PKR2-signaling pathway is involved in regulating functional adequate capillarization in late pregnancy. PMID: 23891065
  12. TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2. PMID: 24487590
  13. The V331M variant confers a lower risk for recurrent miscarriage. PMID: 23687280
  14. An unexpectedly high prevalence of PROKR2 mutations was found in Kallmann syndrome patients from the Maghreb. PMID: 24031091
  15. The distal region of the IL3 region of PROKR2 may differentially influence receptor trafficking and G-protein coupling. PMID: 23969157
  16. PROKR2 signaling does not directly affect Sertoli cell function in autosomal recessive Kallmann syndrome. PMID: 23200691
  17. The role of PROKR2 in the etiology of congenital hypopituitarism, septo-optic dysplasia, and Kallmann syndrome remains uncertain. PMID: 23386640
  18. An ancient founder missense mutation in PROKR2 impairs human reproduction. PMID: 22773735
  19. The R80C mutant of PROKR2 exerts a dominant negative effect on wild-type PROKR2 by interfering with wild-type receptor expression. PMID: 22745195
  20. PROKR2 variants were identified in congenital hypopituitarism with pituitary stalk interruption, suggesting a potential role for the prokineticin pathway in pituitary development. PMID: 22466334
  21. hCG increases EG-VEGF, PROKR1, and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, demonstrating a new role for hCG in regulating EG-VEGF and its receptors. PMID: 22138749
  22. Genetic association studies in 103 patients from the US and UK: Mutations in PROKR2, FGFR1, or FGF8 contributed to 7.8% of patients with combined pituitary hormone deficiency or septo-optic dysplasia. Data suggest genetic overlap with Kallmann syndrome. PMID: 22319038
  23. The results suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2. PMID: 22132188
  24. Positive charges in the second intracellular loop mutations of the PKR2 receptor have roles in G-protein coupling and receptor trafficking. PMID: 21454486
  25. Ligation of tubal TLR2 and activation of NFkappaB by C. trachomatis lead to increased tubal PROKR2, thereby predisposing the tubal microenvironment to ectopic implantation. PMID: 21224062
  26. One tag SNP of PKR2 (rs6053283) was significantly associated with idiopathic recurrent pregnancy loss. PMID: 20847187
  27. Patients with this genetic form of Kallmann syndrome have been reported to have a possible increased prevalence of obesity and sleep disorders, which may be related to the role of PROKR2 in food intake and circadian rhythms (Review). PMID: 20389090
  28. PROKR2 may play a role in the pathophysiology of methamphetamine dependence in the Japanese population. PMID: 20576534
  29. The functional characteristics of coronary endothelial cells depend on the expression of PKR1 and PKR2 levels and the divergent signaling pathways used by these receptors. PMID: 20023120
  30. Molecular cloning, amino acid sequence, and expression in several human tissues. PMID: 12427552
  31. Two Kallmann syndrome patients presented a heterozygous T-to-G transversion in exon 2 (c.518T>G). PMID: 18723471
  32. In Kallmann syndrome patients, ten different missense mutations have been identified in PROKR2. PMID: 18826963
  33. Results suggest that PROKR2 may play a role in the pathophysiology of mood disorders in the Japanese population. PMID: 19544013

Show More

Hide All

Database Links

HGNC: 15836

OMIM: 244200

KEGG: hsa:128674

STRING: 9606.ENSP00000217270

UniGene: Hs.375029

Involvement In Disease
Hypogonadotropic hypogonadism 3 with or without anosmia (HH3)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the ileocecum, thyroid gland, pituitary gland, salivary gland, adrenal gland, testis, ovary and brain.

Q&A

What is Prokineticin Receptor 2 and what are its primary biological functions?

Prokineticin Receptor 2 (PROKR2) is a G-protein coupled receptor that binds both Prokineticin 1 (PROK1) and Prokineticin 2 (PROK2), with PROK2 showing slightly higher binding affinity. While initially named for its role in stimulating gastrointestinal motility, PROKR2 has since been identified as a critical regulator of olfactory bulb morphogenesis and sexual maturation in mammals .

PROKR2 exhibits distinct anatomical expression patterns that explain its diverse biological functions. It is abundantly expressed in the brain—particularly in the olfactory bulb, subventricular zone, preoptic area, paraventricular nucleus, arcuate nucleus, and median eminence—as well as in the testes. This expression pattern contrasts with PROKR1, which is predominantly expressed in peripheral tissues including spleen, prostate, pancreas, heart, and blood cells .

How does PROKR2 signaling function at the molecular level?

PROKR2 activates multiple G-protein pathways common to GPCRs, including:

  • Gαi/o pathway: Activates the MAPK/ERK signaling cascade

  • Gαq pathway: Triggers the IP3/Ca²⁺ release pathway

  • Gαs pathway: Stimulates the cAMP signaling pathway

These diverse signaling capabilities allow PROKR2 to mediate various cellular responses depending on the tissue context and physiological conditions. The receptor's signaling can be functionally assessed through several methodologies:

  • Egr1-luciferase assays that measure MAPK/ERK activation

  • Western blot analysis of phosphorylated ERK levels

  • Aequorin-based assays to measure calcium release through the Gαq pathway

What phenotypes are associated with PROKR2 mutations in humans?

PROKR2 mutations are primarily associated with reproductive and olfactory disorders, including:

  • Kallmann Syndrome (KS): Characterized by hypogonadotropic hypogonadism and anosmia/hyposmia

  • Normosmic Idiopathic Hypogonadotropic Hypogonadism (nIHH): Presenting with reproductive dysfunction without olfactory defects

  • More recently, PROKR2 variants have been linked to other endocrine disorders, including isolated growth hormone deficiency and more severe conditions such as septo-optic dysplasia

The varying phenotypes highlight PROKR2's roles in both neurodevelopmental processes and neuroendocrine function. Notably, identical PROKR2 mutations can produce considerable variation in clinical expressivity and penetrance of both reproductive and olfactory phenotypes .

What insights have animal models provided about PROKR2 function?

Mouse knockout models have been instrumental in understanding PROKR2 function. Prokr2-null mice present with:

  • Abnormal olfactory bulb formation

  • Severe atrophy of the reproductive system in both sexes

  • Absence of GnRH-expressing neurons in the hypothalamus

These phenotypes mirror key aspects of Kallmann Syndrome in humans, establishing Prokr2 knockout mice as a valuable model for studying the molecular basis of this condition. Interestingly, while homozygous knockout mice show clear phenotypes, heterozygous mice reportedly develop normally—a contrast to humans, where heterozygous mutations are commonly associated with disease .

What functional assays are recommended for evaluating PROKR2 variants?

When investigating novel or known PROKR2 variants, researchers should consider multiple complementary approaches to assess functional consequences:

  • For MAPK/ERK pathway assessment:

    • Egr1-luciferase assay: Cells are transfected with wild-type or mutant PROKR2 expression plasmids, along with luciferase vectors containing binding sites for EGR1 (a downstream effector of p-ERK). After stimulation with varying PROK2 concentrations, dose-response curves are generated.

    • Western blot analysis: Directly measuring phosphorylated ERK protein levels following PROK2 stimulation .

  • For IP3/Ca²⁺ release pathway (Gαq) assessment:

    • Aequorin-based assays: These rely on transfection methods and measure calcium release in response to receptor activation .

  • For cAMP pathway (Gαs) assessment:

    • cAMP accumulation assays using either radioimmunoassay or ELISA-based detection methods.

Each variant should be evaluated as a percentage of activation compared to wild-type PROKR2, across multiple signaling pathways, as mutations may affect different pathways differentially.

How should researchers approach the challenge of oligogenic inheritance in PROKR2-related disorders?

The investigation of oligogenic inheritance in PROKR2-related disorders requires systematic methodological approaches:

  • Comprehensive genetic screening: Beyond PROKR2, panels should include genes frequently found in oligogenic combinations with PROKR2, particularly FGFR1, CHD7, ANOS1, PROK2, GNRHR, and SEMA3A .

  • Family studies: Detailed phenotyping of family members carrying the same PROKR2 variants can reveal patterns of variable expressivity and incomplete penetrance that suggest oligogenic inheritance.

  • Functional validation of variant combinations: When multiple variants are identified, functional studies should assess potential synergistic or additive effects on signaling pathways.

  • Genome-wide approaches: For subjects with heterozygous PROKR2 mutations, whole exome or genome sequencing can identify additional genetic factors that may contribute to the phenotype .

The first reported case of oligogenicity involved a patient with Kallmann Syndrome carrying mutations in both PROK2 (ligand) and PROKR2 (receptor), demonstrating how defects in the same pathway can compound to produce disease .

What explains the "heterozygosity puzzle" in PROKR2 mutations?

The "heterozygosity puzzle" refers to the observation that while heterozygous Prokr2 knockout mice develop normally, humans with heterozygous PROKR2 mutations frequently display clinical phenotypes. This discrepancy suggests more complex regulatory mechanisms in humans compared to mice.

Potential explanations researchers should consider when investigating this phenomenon include:

  • Oligogenic inheritance: Heterozygous PROKR2 mutations may interact with variants in other genes related to GnRH neuronal development or function.

  • Genetic background effects: Different genetic backgrounds may influence the penetrance and expressivity of PROKR2 mutations.

  • Nonsense-mediated decay and compensation: For certain PROKR2 variants (especially nonsense mutations), genetic compensation through increased transcription of adapting genes like PROKR1 may occur. PROKR1 and PROKR2 share ligands and have high homology, making this compensation plausible .

  • Developmental timing differences: Species-specific differences in the timing of GnRH neuronal development may influence the impact of heterozygous mutations.

How can researchers investigate the "dual defect" hypothesis in PROKR2-related disorders?

Some patients with PROKR2 mutations exhibit persistent oligospermia or azoospermia despite gonadotropin treatment, suggesting a dual defect affecting both hypothalamic GnRH production and primary gonadal function . To investigate this hypothesis:

  • Expression analysis: Characterize PROKR2 expression patterns in human testicular tissue, particularly in spermatocytes, building on evidence that PROKR2 is expressed in primary spermatocytes.

  • Human gonadal phenotyping: Detailed phenotyping of gonadal function in patients with PROKR2 mutations, including testicular biopsy when appropriate, to identify specific spermatogenic defects.

  • Conditional knockout models: Develop gonad-specific Prokr2 knockout mice to isolate the gonadal effects from hypothalamic effects.

  • Genome-wide association studies: Further explore the association between PROKR2 variants and male infertility, building on pilot data linking a tagging SNP near the PROK2 gene with oligospermia and azoospermia .

  • In vitro spermatogenesis models: Use in vitro models of spermatogenesis to directly test the effects of PROKR2 mutations on specific stages of sperm development.

How do researchers interpret discordant effects of PROKR2 mutations on different signaling pathways?

PROKR2 mutations can affect multiple signaling pathways differentially, creating complex phenotypic consequences. When analyzing functional data showing discordant effects:

  • Structural mapping: Map mutations onto the receptor structure to identify which functional domains are affected (ligand binding, G-protein coupling, internalization). Different domains may preferentially couple to specific signaling pathways.

  • Biased signaling analysis: Quantitatively compare the degree of impairment across different pathways (MAPK/ERK, IP3/Ca²⁺, cAMP) to determine if mutations create biased signaling profiles.

  • Physiological relevance assessment: Determine which signaling pathways are most critical in specific tissues relevant to the clinical phenotype.

  • Experimental design considerations:

    • Use multiple cell types for functional assays

    • Test both short-term and long-term signaling effects

    • Assess receptor localization and trafficking in addition to signaling output

What are the current hypotheses explaining why PROKR2 is not expressed on GnRH neurons despite its critical role in GnRH neuronal development?

One of the puzzling observations in PROKR2 biology is that despite its essential role in GnRH neuronal development and function, the PROKR2 receptor is conspicuously absent on both developing and mature adult GnRH neurons . This suggests indirect mechanisms of action.

Current research hypotheses include:

  • Intermediary pathway hypothesis: PROKR2 may regulate other neuronal populations or factors that directly influence GnRH neuronal migration and function.

  • Developmental timing effects: PROKR2 might be transiently expressed during critical windows of GnRH neuronal development but downregulated in mature neurons.

  • Non-cell-autonomous effects: PROKR2 signaling in the surrounding neural environment may establish guidance cues or permissive conditions for GnRH neuronal migration.

  • Glial cell mediation: PROKR2 expression in glial cells might indirectly regulate GnRH neuronal function through glial-neuronal communication.

Research approaches to test these hypotheses include single-cell transcriptomics of the developing olfactory/hypothalamic region, conditional and cell-type-specific knockout models, and co-culture systems to identify intermediate signaling factors.

What are the most promising areas for future PROKR2 research?

Based on current knowledge gaps and emerging findings, future PROKR2 research should focus on:

  • Systems biology approaches: Identifying interacting proteins, chaperones, transcription factors, and second messengers that mediate PROKR2 signaling .

  • Non-reproductive functions: Investigating PROKR2's roles beyond reproduction, as suggested by additional non-reproductive phenotypes observed in some patients .

  • Therapeutic targeting: Developing agonists or antagonists that can modulate specific PROKR2 signaling pathways for potential therapeutic applications in reproductive disorders.

  • Structural biology: Determining the three-dimensional structure of PROKR2 to better understand ligand binding and receptor activation mechanisms.

  • Precision medicine approaches: Developing personalized treatment strategies based on specific PROKR2 variants and their functional consequences.

The continued study of PROKR2 biology promises to advance our understanding of reproductive neuroendocrinology and may provide new therapeutic avenues for patients with reproductive and developmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.