Recombinant Human Prolactin receptor (PRLR)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant PRLR is generated via transient transfection in mammalian systems (e.g., HEK293 cells) :

  • Expression Systems: HEK293 cells yield soluble, functional receptors with >98% purity .

  • Tags: N-terminal His-tag facilitates nickel-affinity chromatography .

  • Endotoxin Levels: <1 EU/μg, suitable for cell-based assays .

Functional and Signaling Roles

Recombinant PRLR retains native signaling capabilities:

Key Pathways :

  • JAK2-STAT5: Primary pathway for gene transcription (e.g., β-casein) .

  • Ras-Raf-MAPK: Regulates cell proliferation and survival .

  • PI3K/AKT/mTOR: Anti-apoptotic and metabolic regulation .

Functional Assays:

  • Ligand Binding: Recombinant PRLR binds human PRL (K<sub>d</sub> ~0.04–0.24 µg/mL) .

  • Dimerization: PRL induces receptor homodimerization, essential for signaling . Heterodimers (e.g., long + intermediate isoforms) enhance oncogenic transformation .

A. Cancer Biology

  • Breast Cancer: Co-expression of intermediate (hPRLrI) and long (hPRLrL) isoforms drives transformation via stable heterodimers, activating MAPK and suppressing STAT5 .

  • Triple-Negative Breast Cancer (TNBC): High hPRLrI expression correlates with tumor grade and Ki67 proliferation index .

B. Reproductive Studies

  • Recombinant PRLR inhibits sperm capacitation by suppressing SRC kinase and stimulating AKT .

C. Drug Development

  • Used to screen PRLR antagonists (e.g., ΔS1 isoform mutants) .

Clinical and Pathological Relevance

  • Variants: Germline mutations (e.g., Ile146Leu, Asn492Ile) alter signaling:

    • Ile146Leu: Constitutive activation linked to benign breast disease .

    • Asn492Ile: Associated with prolactinoma via PI3K-Akt hyperactivation .

  • Therapeutic Target: PRLR is expressed in 95% of breast cancers; inhibition reduces proliferation and metastasis .

Research Challenges and Innovations

  • Isoform-Specific Reagents: Limited antibodies hinder isoform-specific studies .

  • Structural Insights: Cryo-EM and NMR (PDB: 3NPZ, 2LFG) guide drug design .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol.
Please note: If you have specific requirements regarding the glycerol content, please specify them in your order remarks.
For lyophilized powder delivery forms, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.

Form
Delivery forms are available as Liquid or Lyophilized powder.
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order remarks and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the product for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Synonyms
PRLR; Prolactin receptor; PRL-R
Datasheet & Coa
Please contact us to get it.
Expression Region
25-622aa
Mol. Weight
71.9kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
The Prolactin receptor (PRLR) acts as a receptor for the anterior pituitary hormone prolactin (PRL). It serves as a prosurvival factor for spermatozoa by inhibiting sperm capacitation. This inhibition is achieved through the suppression of SRC kinase activation and the stimulation of AKT. Isoform 4 lacks the ability to transduce prolactin signaling, while Isoform 6 also exhibits a similar lack of signaling transduction.
Gene References Into Functions
  1. In a replication study investigating the association between the prolactin receptor gene intron C/T polymorphism (rs37389) and recurrent miscarriage, no association was found. PMID: 28980840
  2. Low PRLR expression is associated with Triple Negative Breast Cancer. PMID: 27480353
  3. Promising antitumor activity against PRLR-positive breast cancer xenografts has been observed, suggesting the potential of anti-PRLR antibody-drug conjugates as therapeutic agents in breast cancer. PMID: 28377489
  4. Prl receptor is expressed at varying levels in the majority of glioblastoma multiforme tumors. Prolactin stimulation leads to increased STAT5 phosphorylation and enhanced cellular invasion. PMID: 27788487
  5. PRLRI146L and PRLRI176V variants have been found to be unrelated to breast cancer or multiple breast fibroadenomas risk. PMID: 27575941
  6. This study identified 4 PRLR variations (p.Ile76Val, p.Ile146Leu, p.Glu108Lys and p.Glu554Gln) in 16 Sporadic Prolactinoma in Humans. PMID: 26641246
  7. Research highlights PRLR as an independent predictor of favorable prognosis in human breast cancer. PMID: 26317306
  8. Two markers for the PRL peptide gene and three markers for the prolactin receptor (PRLR) gene were genotyped. PMID: 26513615
  9. The prolactin receptor is constitutively expressed on regulatory T and effector T cells in systemic lupus erythematosus patients, and this expression is higher than in healthy individuals. PMID: 26844452
  10. There is a potential role for PRLR in the progression of cervical cancer. PMID: 24990775
  11. This study underscores the critical role of position 146 in determining the intrinsic properties of the PRLR, encompassing extracellular domain folding, PRL-responsiveness, and ligand-independent activity of the receptor. PMID: 25524456
  12. Data suggest that (1) cell membrane/lipid bilayer binding of PRLR and (2) tyrosine phosphorylation of PRLR intracellular domain are independent processes. PMID: 25846210
  13. The long PRLR isoform plays a significant role in breast cancer metastasis. PMID: 26095602
  14. A residue quartet in the extracellular membrane proximal domain of the homodimeric cytokine receptor prolactin receptor acts as a key regulator of intracellular signaling discrimination. PMID: 25784554
  15. PRL induces transient signaling pathways in neurons and modulates ion channels. [review] PMID: 24758841
  16. Exposure to prolactin increases TNF-alpha release from CD14(+) monocytes of rheumatoid arthritis patients, which can be abolished by PRLR gene silencing or treatment with MAPK inhibitor. PMID: 24997655
  17. High MFAB expression is associated with testicular germ cell tumor and glioblastomas. PMID: 24391856
  18. Negative/low expression is associated with poorly differentiated and larger breast tumors in Poland. PMID: 24249584
  19. Single mutations in critical regions of D1 trigger major changes in prolactin receptor conformation and dimerization affinity. PMID: 24735798
  20. PRL-R attenuation post-transcriptionally increased ZnT2 abundance and redistributed intracellular Zn pools into lysosomes and mitochondria. PMID: 24333596
  21. Hypertrimethylation on H3K27 of the p53 gene promoter region due to elevated expression of DeltaS2 PRLR by alternative splicing of the pre-mRNA in its full-length form might serve as a new mechanism underlying prostate cancer. PMID: 24032713
  22. Data suggest that signal transduction via prolactin and prolactin receptor plays a role in trophoblast cell migration and invasion; PRLR is expressed by extravillous cytotrophoblasts and first-trimester placental bed tissue. PMID: 23849393
  23. PRL-induced transient signaling in sensory neurons is governed by PI3K or PKCepsilon, mediated via the PRLR-S isoform, and transient effects mediated by PRLR-S are inhibited by the presence of PRLR-L in these cells. PMID: 24142695
  24. SNPs of the PRLR gene 5' UTR and promoter region are associated with an increased risk for gestational diabetes in a population of Chilean subjects. PMID: 23651351
  25. Thus, familial hyperprolactinemia appears to be caused by a germline, loss-of-function mutation in PRLR, resulting in prolactin insensitivity. PMID: 24195502
  26. Results demonstrate a novel function for hepatic PRLR in the regulation of insulin sensitivity and provide important insights concerning the nutritional regulation of PRLR expression. PMID: 23775766
  27. Our data suggest that prolactin receptor presence meaningfully affects growth hormone receptor use in breast cancer cells. PMID: 23192981
  28. The prolactin receptor transactivation domain is associated with steroid hormone receptor expression and malignant progression of breast cancer. PMID: 23159947
  29. Our results indicate no significant association of prolactin and PRLR polymorphisms with clozapine response, tardive dyskinesia diagnosis, or its severity in patients with schizophrenia. PMID: 21305610
  30. The Prolactin receptor can be activated by three sequence-diverse human hormones: prolactin, GH, and placental lactogen. [review] PMID: 22577091
  31. PRLr isoforms expression and PRLr subcellular localisation are altered in parathyroid tumours. PMID: 22606260
  32. The structure of the human prolactin receptor reveals a structural link between the WSXWS motif, hormone binding, and receptor dimerization, suggesting a general mechanism for class 1 receptor activation. PMID: 22325776
  33. PRL signaling through the long form prolactin receptor causes reduced fatty acid oxidation, increased lipid storage, glucose intolerance, and obesity. PMID: 21989556
  34. Data provide limited support for an association between common variations in PRLR and breast cancer risk. PMID: 21470416
  35. The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth. PMID: 21816901
  36. Our study suggests that the prolactin receptor gene is a molecular target that may be important in the pathogenesis and progression of lobular neoplasia. PMID: 20658264
  37. Enhanced complex formation of ERalpha dimer with SP1 and C/EBPbeta by E2 plays a crucial role in the transcriptional activation of the hPRLR gene. PMID: 21670145
  38. Data show that cells expressing higher long:short PRLR ratios had increased growth, survival, and migration in response to PRL, suggesting that PRLR antagonists may be therapeutically beneficial in ovarian cancer. PMID: 21775057
  39. Endogenous GH receptor(GHR) and PRLR associate, possibly as a GHR-PRLR heterodimer, in human breast cancer cells, and GH signaling in these cells is largely mediated by the PRLR in the context of both PRLR-PRLR homodimers and GHR-PRLR heterodimers. PMID: 21310852
  40. The positive correlations in positivity rate between the PRL-R and ER/PR expressions are found only in CerbB-2 positive patients with breast cancer. PMID: 20335148
  41. SIRPalpha modulates PRL receptor-associated signaling as a function of integrin occupancy by mediating integrin-PRL receptor cross-talk and contributing to breast cancer biology. PMID: 20826546
  42. Both Zn(2+) and human PRLr binding influence human PRL conformers in an interdependent manner. PMID: 21510945
  43. Functional impact of manipulation on the relative orientation of human prolactin receptor domains. PMID: 21591677
  44. Progesterone induces expression of the prolactin receptor gene through cooperative action of Sp1 and C/EBP transcription factors. PMID: 21238538
  45. Rabbit antibodies have high titers and can specifically recognize each isoform of PRLR in breast cancer cell lines and human breast carcinoma biopsies. PMID: 21144038
  46. Prolactin receptor signaling contributes to the local inflammatory response within the atherosclerotic plaque and thus to atherogenesis. PMID: 21068074
  47. Blockade of the PRLR represents a novel treatment approach for patients with advanced breast or prostate cancer who have limited therapeutic options. PMID: 20846877
  48. Acetylation and deacetylation provide a rheostat-like regulation for the cytokine receptor PRLR in its cytoplasmic loop dimerization and subsequent STAT5 activation. PMID: 20962278
  49. This study enabled the visualization, for the first time, of the loop L5 spanning PRLR2 residues Thr133-Phe140, revealing its central implication for the three intermolecular interfaces of the 1:2 complex between natural prolactin and two PRLR chains. PMID: 20875426
  50. Prolactin receptor expression is common in colorectal cancer. PMID: 20453834

Show More

Hide All

Database Links

HGNC: 9446

OMIM: 176761

KEGG: hsa:5618

STRING: 9606.ENSP00000371432

UniGene: Hs.368587

Involvement In Disease
Multiple fibroadenomas of the breast (MFAB); Hyperprolactinemia (HPRL)
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 7]: Secreted.
Tissue Specificity
Expressed in breast, placenta, kidney, liver and pancreas.

Q&A

What is the basic structure of human Prolactin Receptor?

Human Prolactin Receptor is a cytokine hematopoietic receptor protein with an extracellular domain (ECD) that binds to prolactin molecules. The receptor's extracellular domain spans from Gln25 to Asp234 in its amino acid sequence, as identified by its accession number P16471 . The functional receptor consists of a single-pass transmembrane protein that typically forms dimers upon prolactin binding. The extracellular domain contains recognition motifs that are critical for ligand-receptor interactions, while the intracellular domain mediates downstream signaling through various pathways .

How does Prolactin interact with its receptor at the molecular level?

The prolactin molecule is thought to bind to two receptor molecules, forming a signaling complex . This interaction follows a sequential binding model where one prolactin molecule first binds to one receptor molecule with high affinity, followed by recruitment of a second receptor molecule with lower affinity. The binding occurs primarily through the extracellular domain of the receptor, which contains specific binding sites that recognize distinct epitopes on the prolactin molecule. This binding initiates conformational changes that activate intracellular signaling cascades .

What are the key amino acid sequences involved in PRLR-PRL binding?

The key sequence for recombinant human PRLR typically spans from amino acids Leu29 to Cys227, which constitutes the functionally active region of the protein . In particular, the extracellular domain (ECD) of PRLR, which spans from Gln25 to Asp234, contains the critical binding sites for prolactin . Research shows that specific amino acid residues within this region are essential for the receptor-ligand interaction. The sequence is highly conserved across species, indicating its functional importance in prolactin signaling .

What expression systems are commonly used for recombinant PRLR production?

Common expression systems for recombinant PRLR production include E. coli and mammalian cell lines such as HEK293 cells. The E. coli system is typically used for producing the extracellular domain of PRLR, as demonstrated in the production of recombinant Human Prolactin/PRL protein where the target gene encoding Leu29-Cys227 is expressed . For full-length or more complex forms of PRLR requiring post-translational modifications, HEK293 cells are often preferred, as they can produce proteins with >98% purity and appropriately folded structures .

How can researchers achieve large-scale production of PRLR-ECD?

Novel protocols have been developed for large-scale preparation of human PRLR extracellular domain (PRLR-ECD). These protocols typically involve optimized expression vectors, carefully selected host systems, and refined purification strategies. The process includes gene cloning into appropriate expression vectors, transformation into host cells (such as E. coli or HEK293), induction of protein expression, cell lysis, and multiple chromatography steps for purification . These methods have demonstrated significant improvements in yield, with some protocols showing >6-fold increases in production efficiency compared to previous methods .

What are the critical quality control parameters for recombinant PRLR production?

Critical quality control parameters for recombinant PRLR production include purity, endotoxin levels, and functional activity. Purity is typically assessed using reducing SDS-PAGE, with high-quality preparations showing >95% purity . Endotoxin levels should be maintained below 1.0 EU per μg as determined by the LAL method to ensure the product is suitable for in vitro and in vivo research applications . Functional activity is assessed through binding assays with prolactin, and through biological assays measuring downstream signaling or proliferative responses in appropriate cell lines .

How can PRLR-ECD be used in binding assays to study prolactin-receptor interactions?

PRLR-ECD can be used in several types of binding assays to study prolactin-receptor interactions. One approach is a competitive non-radioactive binding assay using biotinylated human prolactin (hPRL) as the ligand and human PRLR-ECD as the receptor . Another method involves assessing the formation of stable 1:1 complexes between PRLR-ECD and prolactin (or prolactin antagonists) under non-denaturing conditions using size-exclusion chromatography . Surface plasmon resonance (SPR) methodology can also be employed to determine binding kinetics and affinity constants between PRLR-ECD and various ligands, providing real-time interaction data .

What cell-based assays can be used to evaluate PRLR signaling and functionality?

Several cell-based assays can be used to evaluate PRLR signaling and functionality. A commonly used approach is the proliferation assay using cell lines that express PRLR, such as Baf/LP cells stably expressing human PRLR or Nb2-11 rat lymphoma cells . In these assays, cell proliferation induced by prolactin can be measured, and the inhibitory effects of antagonists can be quantified. Additionally, metabolic activity assays following incubation with prolactin (PRL), PRL-antibodies, or PRLR-antibodies can be performed in various cell lines, including cancer cell lines (HeLa, SiHa, C-33A) and control cells (MCF-7, T-47D, HaCaT) .

How can researchers detect and quantify PRLR expression in different cell types?

PRLR expression in different cell types can be detected and quantified using multiple complementary techniques. Western blotting using specific antibodies against PRLR can identify the receptor proteins by their characteristic molecular weight . Immunocytochemistry can be employed to visualize the cellular localization of PRLR using secondary antibodies conjugated with fluorescent markers (such as Alexa Fluor 488) . For quantitative assessment, real-time RT-PCR can measure relative expression levels of PRLR mRNA . Additionally, flow cytometry using specific antibodies can be used to quantify cell surface expression of PRLR across different cell populations.

What is del 1-9-G129R hPRL and how does it function as a PRLR antagonist?

Del 1-9-G129R hPRL is a genetically engineered variant of human prolactin that functions as a pure antagonist of human PRL in binding to the PRLR extracellular domain. This molecule has been designed by deleting the first 9 amino acids and introducing a glycine to arginine substitution at position 129 of the human prolactin sequence . This modified protein can bind to PRLR with affinity similar to wild-type prolactin but fails to activate downstream signaling pathways. Functionally, del 1-9-G129R hPRL inhibits prolactin-induced proliferation of cells expressing PRLR, such as Baf/LP cells, making it a valuable tool for studying prolactin-dependent signaling and potential therapeutic applications .

How can researchers evaluate the efficacy of PRLR antagonists in experimental settings?

Researchers can evaluate the efficacy of PRLR antagonists through multiple complementary approaches. Competitive binding assays can assess the antagonist's ability to displace prolactin from binding to PRLR-ECD . Cell proliferation assays using cell lines like Baf/LP or Nb2-11 can measure the antagonist's capacity to inhibit prolactin-induced proliferation . Formation of stable complexes between the antagonist and PRLR-ECD can be analyzed using size-exclusion chromatography under non-denaturing conditions . Additionally, surface plasmon resonance can determine binding kinetics and affinity constants. For in vivo efficacy, the antagonist's ability to block prolactin-dependent physiological responses in appropriate animal models can be assessed .

What strategies are being developed to create high-affinity PRLR antagonists?

Novel strategies for developing high-affinity PRLR antagonists include yeast surface display methodology. In this approach, del 1-9-G129R hPRL is expressed on the surface of yeast cells where it retains its binding capacity for PRLR-ECD . This display system allows for the development of randomly mutated libraries of the del 1-9-G129R hPRL open reading frame, from which high-affinity variants can be selected through successive rounds of binding and enrichment . Another approach involves the creation of pegylated analogues of prolactin antagonists to provide long-lasting activity for in vivo experiments, although this modification may affect the biological activity in vitro .

What role does PRLR play in cancer development and progression?

PRLR plays significant roles in the development and progression of various cancers, particularly breast and prostate cancers . In cervical cancer cell lines (HeLa, SiHa, C-33A), PRLR expression has been detected at both protein and mRNA levels, with different cell lines showing variable expression patterns . Studies have demonstrated that prolactin can affect the metabolic activity and proliferation of these cancer cells, effects that can be blocked using specific PRLR antibodies . This suggests that PRLR signaling contributes to cancer cell growth and survival. The receptor's expression in various cancer types makes it a potential target for therapeutic interventions aimed at blocking prolactin-dependent tumor growth .

How do PRLR blocking antibodies affect cancer cell proliferation?

PRLR blocking antibodies can significantly impact cancer cell proliferation in a cell type-dependent manner. In cervical cancer cell lines (HeLa, SiHa, C-33A), anti-PRLR antibodies (at concentrations of 2.5 μg) can inhibit the proliferative effects of prolactin (200 ng/ml) after 3 or 5 days of treatment . Similar effects have been observed in breast cancer cell lines like MCF-7 and T-47D, which are known to express high levels of PRLR . The inhibitory effect occurs through preventing prolactin binding to its receptor, thereby blocking downstream signaling pathways that promote cell growth and survival. These findings highlight the potential therapeutic value of PRLR-targeting strategies in cancers where prolactin signaling contributes to disease progression .

How can pegylation be used to modify recombinant PRLR for enhanced in vivo applications?

Pegylation of recombinant PRLR and related proteins can create long-lasting analogues needed for in vivo experiments. This process involves the covalent attachment of polyethylene glycol (PEG) molecules to specific sites on the protein . Mono-pegylated analogues of human prolactin have been developed for this purpose, though research indicates that pegylation typically lowers biological activity in homologous in vitro assays . The primary advantage of pegylation is the significant increase in the protein's half-life in circulation, making it more suitable for in vivo studies. The optimal pegylation strategy must balance the trade-off between extended half-life and maintained biological activity, which can be achieved through careful selection of PEG size, attachment site, and chemistry .

What analytical techniques are most effective for characterizing PRLR-ligand interactions?

Multiple analytical techniques are effective for characterizing PRLR-ligand interactions, each offering unique insights. Surface plasmon resonance (SPR) provides real-time binding kinetics and affinity constants between PRLR-ECD and various ligands . Size-exclusion chromatography under non-denaturing conditions can assess the formation of stable complexes and determine their stoichiometry . Competitive binding assays using biotinylated ligands can evaluate the relative affinities of different compounds . For structural insights, X-ray crystallography and cryo-electron microscopy can reveal the three-dimensional organization of receptor-ligand complexes. Hydrogen-deuterium exchange mass spectrometry can identify regions involved in binding by measuring changes in solvent accessibility. These complementary approaches provide comprehensive characterization of PRLR-ligand interactions for both basic research and drug development purposes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.