Recombinant Human Proline-rich protein 24 (PRR24)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
INAFM1; PRR24; Putative transmembrane protein INAFM1; InaF-motif-containing protein 1; Proline-rich protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
INAFM1
Target Protein Sequence
MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRS PAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDP DRRPSRQTPRETPEAAEGRRPG
Uniprot No.

Target Background

Database Links

HGNC: 27406

KEGG: hsa:255783

STRING: 9606.ENSP00000447679

UniGene: Hs.128690

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems have been successfully used for recombinant PRR24 production?

E. coli has been documented as a successful expression system for full-length human PRR24 . When designing expression constructs, consider these methodological approaches:

  • Fusion tags: Using N-terminal His-tags facilitates purification while potentially enhancing solubility .

  • Codon optimization: Essential for high-level expression in E. coli, as proline codons can be limiting factors in heterologous expression.

  • Expression temperature: Lower temperatures (25°C) often improve soluble expression of proline-rich proteins by slowing folding kinetics and preventing aggregation .

For challenging proline-rich proteins, alternative expression systems like baculovirus/insect cells might be considered, which have been successful for other proline-rich proteins like SPRRs .

What are the most significant challenges in expressing proline-rich proteins like PRR24?

Recombinant expression of proline-rich proteins presents several methodological challenges:

  • Ribosomal stalling: Consecutive proline residues can cause translational arrest during protein synthesis. Research on ALIX-PRD showed that regions containing PPPP and PPYP motifs were particularly problematic for expression .

  • Protein solubility: The unique structural properties of proline-rich regions can lead to protein aggregation.

  • Protein yield: Lower expression levels are common due to the metabolic burden of proline synthesis and incorporation.

To address these challenges, a "divide-and-conquer" approach might be necessary for some proline-rich proteins, expressing separate domains when full-length expression is problematic .

How can experimental design methodology optimize recombinant PRR24 expression?

Systematic optimization of expression conditions using factorial experimental design is recommended:

  • Multivariate analysis: Instead of changing one variable at a time, use a factorial design approach to evaluate multiple parameters simultaneously. For example, an 8-variable factorial design (2^8-4) can be employed to test:

    • Induction absorbance (cell density at induction)

    • IPTG concentration

    • Expression temperature

    • Media components (yeast extract, tryptone, glucose concentrations)

    • Induction time

  • Statistical evaluation: Analyze results using p-values (p<0.1 is often used for screening designs) to identify statistically significant effects of each variable .

Based on studies with other recombinant proteins, optimal conditions might include:

  • Induction at mid-exponential phase (OD600 ~0.8)

  • Low IPTG concentration (0.1-0.2 mM)

  • Expression temperature of 25°C

  • Enriched media with glucose supplementation (1 g/L)

VariableOptimal ConditionEffect on Protein Expressionp-value
Induction absorbance0.8Positive effect on cell growth and protein activity<0.0001
IPTG concentration0.1 mMNegative effect on cell growth, minimal impact on activity0.0387
Expression temperature25°CPositive effect on cell growth, negative effect on protein activity<0.0001
Induction time4 hoursOptimal for productivity-

What purification strategies are most effective for recombinant PRR24?

For His-tagged recombinant PRR24, the following purification workflow is recommended:

  • Cell lysis: Sonication (10 min, repeated 5s on, 10s off cycle) in lysis buffer (20 mM Tris pH 8.0, 500 mM NaCl) .

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin.

  • Size exclusion chromatography: For higher purity, particularly important for structural or interaction studies.

For non-tagged PRR24, ion-exchange chromatography can be effective due to its high isoelectric point. Expanded bed adsorption with a cation exchange column (e.g., Streamline SP XL) equilibrated in 50 mM Tris-HCl, pH 8.0 has been successful for other proline-rich proteins .

What analytical methods are suitable for characterizing recombinant PRR24?

A comprehensive characterization requires multiple techniques:

How can potential protein-protein interactions of PRR24 be effectively studied?

Several methodological approaches can be employed:

  • NMR-based interaction studies: For mapping interaction sites at atomic resolution. Heteronuclear NMR spectroscopy with 15N-labeled PRR24 can reveal binding sites through chemical shift perturbations upon addition of unlabeled binding partners .

  • Surface Plasmon Resonance (SPR): For kinetic and thermodynamic characterization of interactions.

  • Isothermal Titration Calorimetry (ITC): To determine binding stoichiometry, affinity, and thermodynamic parameters.

  • Pull-down assays: Using His-tagged PRR24 as bait to identify novel interaction partners from cellular lysates.

For proline-rich proteins, specialized considerations include:

  • Multiple binding sites may exist with differential affinities

  • Interactions may be regulated by post-translational modifications

  • The intrinsically disordered nature may lead to complex binding kinetics

What research design is most appropriate for studying PRR24 function in cellular contexts?

The optimal research design depends on the specific research question:

  • For causal relationships: Fully experimental designs, typically randomized controlled trials (RCTs), are most appropriate .

  • When randomization is impractical: Consider quasi-experimental designs including:

    • Pre-post designs with non-equivalent control groups

    • Interrupted time series (ITS)

    • Stepped wedge designs

For cellular studies of PRR24, consider:

  • Between-subjects designs: Different cell lines or treatments compared in parallel

  • Within-subjects designs: Same cell population measured before and after treatment

Careful consideration of variables is essential:

  • Independent variable: Treatment conditions (e.g., PRR24 expression levels)

  • Dependent variable: Measured outcomes (e.g., cellular phenotypes)

  • Confounding variables: Other factors that may influence results

How should statistical significance be assessed in PRR24 experiments?

Appropriate statistical analysis depends on experimental design:

  • For factorial experimental designs: Use ANOVA to analyze main effects and interactions between factors. Report effect sizes and p-values.

  • For dose-response studies: Consider non-linear regression models appropriate for the biological system.

  • For time-course experiments: Repeated measures ANOVA or mixed models are appropriate.

When reporting results:

  • Clearly define sample sizes and statistical tests used

  • Report exact p-values rather than thresholds

  • Include measures of effect size

  • Consider biological significance alongside statistical significance

What considerations are important when designing experiments to investigate PRR24 induction by cellular stimuli?

Based on studies of other proline-rich proteins like SPRRs, consider these methodological approaches:

  • Dose optimization: Conduct preliminary dose-response experiments to determine optimal concentrations of inducers. For example, 1 μg LPS was found optimal for SPRR induction in human cells .

  • Time course analysis: Determine optimal time points for measuring expression changes. For instance, 16 hours post-treatment was optimal for SPRR induction .

  • Measurement techniques:

    • qRT-PCR for transcript quantification

    • Western blotting for protein expression analysis

    • Functional assays specific to the protein's role

  • Appropriate controls: Include vehicle controls and positive controls (known inducers of similar proteins).

  • Replication: Include biological replicates (n≥3) to ensure reproducibility and allow statistical analysis .

How can researchers address challenges in reproducing PRR24 experimental results across different laboratories?

Reproducibility challenges in recombinant protein studies can be addressed through:

  • Detailed methodology reporting: Include comprehensive information on:

    • Expression construct design (including complete sequence)

    • Expression conditions (media composition, temperature, induction parameters)

    • Purification protocol with buffer compositions

    • Storage conditions and stability assessments

  • Standardized characterization: Report multiple protein quality metrics:

    • Purity (SDS-PAGE, SEC)

    • Identity (MS, N-terminal sequencing)

    • Functional activity (protein-specific assays)

    • Structural integrity (CD, fluorescence spectroscopy)

  • Statistical rigor: Use appropriate statistical methods and report:

    • Sample sizes

    • Number of independent experiments

    • Statistical tests with justification

    • Effect sizes alongside p-values

How can recombinant PRR24 be used for structural biology studies?

Structural studies of proline-rich proteins present unique challenges requiring specialized approaches:

  • NMR spectroscopy: Particularly valuable for proline-rich proteins due to:

    • Ability to study dynamic, disordered regions

    • Capability to detect multiple conformations

    • Sensitivity to environmental conditions

Isotopic labeling strategies (15N, 13C) are essential, requiring optimized minimal media for expression .

What approaches can be used to study potential post-translational modifications of PRR24?

Based on studies of other proline-rich proteins, consider these methodological approaches:

  • Identification strategies:

    • Mass spectrometry-based proteomics (LC-MS/MS)

    • Western blotting with modification-specific antibodies

    • Specialized staining techniques (e.g., Pro-Q Diamond for phosphorylation)

  • Functional impact assessment:

    • Site-directed mutagenesis to create modification-mimicking mutants

    • In vitro modification using purified enzymes

    • Comparison of properties between modified and unmodified forms

In ALIX-PRD, tyrosine phosphorylation regulated amyloid formation, suggesting potential regulatory roles for PTMs in proline-rich protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.