Recombinant Human Proline-rich transmembrane protein 1 (PRRT1)

What is PRRT1 and what are its known functions?

PRRT1 (Proline-Rich Transmembrane Protein 1) is a protein-coding gene located on chromosome 6p21.32. It is also known by several other designations including NG5, DSPD1, C6orf31, IFITMD7, and SynDIG4. PRRT1 enables identical protein binding activity and is predicted to participate in several neurological processes, including long-term synaptic depression, protein localization to cell surface, and regulation of AMPA receptor activity. Current research indicates that PRRT1 acts upstream of or within several processes, including learning or memory, long-term synaptic potentiation, and synapse organization .

The protein is predicted to be located in the plasma membrane and synaptic vesicle membrane, with activity primarily in glutamatergic synapses and postsynaptic density membranes. The PRRT1 gene contains 6 exons and is found at position NC_000006.12 (32148363..32153083, complement) on chromosome 6 .

How should recombinant PRRT1 protein be stored and handled for optimal stability?

Recombinant PRRT1 protein antigen should be stored at -20°C, and researchers should avoid repeated freeze-thaw cycles that can degrade protein quality. The commercially available recombinant protein is typically provided in PBS buffer containing 1M Urea at pH 7.4 . When working with this protein, it's advisable to:

• Aliquot the protein upon first thaw to minimize freeze-thaw cycles

• Use sterile technique when handling

• Include protease inhibitors if working with the protein in solution for extended periods

• Follow manufacturer's specific recommendations for long-term storage

The shelf life of properly stored recombinant PRRT1 is approximately 365 days from production when maintained under recommended conditions .

What expression systems are used to produce recombinant PRRT1?

The most common expression system for recombinant human PRRT1 protein is Escherichia coli (E. coli). Commercial recombinant PRRT1 protein with N-terminal His6-ABP tag is produced using bacterial expression systems that allow for high-yield production of the target protein .

The expressed protein typically has a molecular weight of approximately 24 kDa and contains the amino acid sequence: PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL . The protein is purified using immobilized metal affinity chromatography (IMAC), which yields a product with greater than 80% purity .

Alternative expression systems such as mammalian, insect, or yeast cells may be used for specific research applications requiring post-translational modifications, though these methods generally produce lower yields compared to bacterial systems.

How does PRRT1 interact with AMPA receptors during synaptic plasticity?

PRRT1 (also known as SynDIG4) has been identified as a critical component in AMPA receptor (AMPAR) regulation. Recent research indicates that PRRT1 engages in protein-protein interactions with AMPAR subunits, mediating both the trafficking and functional properties of these receptors at synapses . During synaptic plasticity events, PRRT1 appears to regulate the lateral mobility and synaptic retention of AMPARs, influencing both long-term potentiation (LTP) and long-term depression (LTD) .

The interaction between PRRT1 and AMPARs occurs primarily at the postsynaptic density, where PRRT1 may serve as a scaffold or adaptor protein that helps position AMPARs appropriately within the membrane. This positioning is critical for proper glutamatergic neurotransmission and synaptic strength modulation .

For researchers studying synaptic plasticity mechanisms, it is recommended to investigate both direct binding assays (such as co-immunoprecipitation or proximity ligation assays) and functional studies (including electrophysiological recordings in PRRT1 knockout or overexpression models) to fully characterize the dynamic relationship between PRRT1 and AMPARs.

What is the clinical significance of PRRT1 expression in epilepsy and potential therapeutic implications?

Research has demonstrated that PRRT1 expression levels in temporal cortical tissue have prognostic value for seizure outcomes following surgical interventions for epilepsy. Specifically, relatively lower expression levels of PRRT1 are predictive of seizure-free outcomes following anterior temporal lobectomy with amygdalohippocampectomy (ATL/AH) . This finding represents the first known function of PRRT1 in epilepsy, opening new avenues for research into potential biomarkers and therapeutic targets.

The predictive value of PRRT1 expression for surgical outcomes is demonstrated in the following clinical data:

Table data from study on cortical gene expression as prognostic value for seizure outcome

For researchers exploring PRRT1 as a potential therapeutic target for epilepsy, it would be valuable to investigate:

• The mechanistic relationship between PRRT1 expression and seizure susceptibility

• Whether pharmacological modulation of PRRT1 or PRRT1-AMPAR interactions could provide anticonvulsant effects

• The development of non-invasive methods to assess PRRT1 expression as a biomarker in epilepsy patients

This research direction has significant translational potential, potentially improving surgical outcome prediction and developing novel therapeutic approaches for epilepsy .

What methodological approaches are most effective for studying PRRT1 function in neural circuits?

Effective investigation of PRRT1 function in neural circuits requires multiple complementary approaches:

• Genetic manipulation techniques: CRISPR/Cas9-mediated knockout or knockdown of PRRT1 in neuronal cultures or animal models provides valuable insights into its physiological role. Conditional knockout models are particularly useful for temporal and spatial specificity in neural circuit analysis.

• High-resolution imaging: Super-resolution microscopy techniques (STED, STORM, PALM) allow visualization of PRRT1 localization at synapses with nanometer precision. Live-cell imaging combined with fluorescently tagged PRRT1 enables monitoring of dynamic changes during synaptic activity.

• Electrophysiological assessments: Whole-cell patch-clamp recordings in PRRT1-manipulated neurons reveal functional consequences on synaptic transmission and plasticity. Long-term potentiation (LTP) and long-term depression (LTD) protocols should be implemented to assess PRRT1's role in activity-dependent synaptic modifications .

• Biochemical interaction studies: Beyond traditional co-immunoprecipitation, proximity labeling techniques (BioID, APEX) can identify the PRRT1 interactome in native synaptic environments. These approaches have revealed PRRT1's association with AMPA receptor complexes .

• Behavioral assays: For animal models with PRRT1 modifications, learning and memory tasks (Morris water maze, fear conditioning, novel object recognition) provide functional readouts relevant to PRRT1's predicted roles in learning and memory processes .

Researchers should consider combining these approaches to build a comprehensive understanding of PRRT1 function across molecular, cellular, circuit, and behavioral levels.

How do genetic variants in PRRT1 correlate with neurological disorders and immune system function?

PRRT1 genetic variants have been associated with both neurological functions and immune system responses. The gene is located at chromosome 6p21.32, a region rich in immune-related genes within the major histocompatibility complex (MHC) . Research has identified links between PRRT1 genetic variants and several conditions:

• Neurological associations: Given PRRT1's role in synaptic function, particularly in glutamatergic neurotransmission and AMPA receptor regulation, variants may contribute to disorders characterized by synaptic dysfunction. The gene's involvement in learning, memory, and synaptic plasticity suggests potential relevance to cognitive disorders .

• Immune-related conditions: Genome-wide studies have shown associations between the chromosomal region containing PRRT1 and:

  • Antibody responses to Epstein-Barr virus nuclear antigen 1 (EBNA-1)

  • N-glycosylation of human immunoglobulin G, with pleiotropy with autoimmune diseases and hematological cancers

When investigating these associations, researchers should employ:

• Targeted sequencing of PRRT1 in patient cohorts

• Functional characterization of identified variants using cell models

• Integration of genomic data with transcriptomic and proteomic analyses

• Assessment of PRRT1 variant effects on both neuronal function and immune response

The dual relevance of PRRT1 to both neurological and immune function suggests potential neuroimmune mechanisms that merit further investigation, particularly in disorders with both neurological and immunological components.

What are the best approaches for validating antibodies against recombinant PRRT1 for research applications?

Validating antibodies against recombinant PRRT1 requires a systematic approach to ensure specificity and reliability in various experimental applications. The following methodology is recommended:

• Competition assays with recombinant protein: Use purified recombinant PRRT1 protein antigen (such as those with N-terminal His6-ABP tag derived from E. coli) as a blocking agent to confirm antibody specificity . This approach verifies that the antibody binding is specifically directed against PRRT1 epitopes.

• Western blot validation: Perform western blots using:

  • Recombinant PRRT1 protein as a positive control

  • Tissue lysates from tissues known to express PRRT1 (brain regions, particularly those containing glutamatergic synapses)

  • Lysates from PRRT1 knockout models as negative controls

  • Multiple antibodies targeting different epitopes of PRRT1 for cross-validation

• Immunohistochemistry/immunocytochemistry controls:

  • Parallel staining with multiple validated antibodies

  • Pre-absorption controls using recombinant PRRT1

  • PRRT1 knockout tissue as negative control

  • Verification of expected subcellular localization (membrane, synaptic structures)

• Mass spectrometry validation: Immunoprecipitate PRRT1 using the antibody and confirm the presence of PRRT1 peptides through mass spectrometry analysis.

• Reproducibility testing: Validate antibody performance across different lots and in multiple experimental settings (different tissue preparations, fixation methods, etc.).

These validation steps are crucial for ensuring reliable results in PRRT1 research, particularly given its important roles in neuronal function and potential as a biomarker for conditions such as epilepsy .

What are the optimal conditions for expressing and purifying recombinant PRRT1 for structural studies?

Optimizing expression and purification of recombinant PRRT1 for structural studies requires careful consideration of several parameters:

• Expression system selection: While E. coli is commonly used for recombinant PRRT1 production , researchers pursuing structural studies should consider:

  • For NMR studies: Isotope labeling (15N, 13C) in minimal media

  • For crystallography: Insect cell or mammalian expression systems may provide better protein folding for transmembrane regions

  • For cryo-EM: Higher yield expression systems that maintain native folding

• Construct design considerations:

  • Include appropriate purification tags (His6 or His6-ABP) at either N- or C-terminus

  • Consider truncation constructs that remove disordered regions while preserving core domains

  • For membrane-associated regions, fusion to stabilizing proteins (e.g., T4 lysozyme) may improve crystallization

• Purification strategy:

  • Initial capture using IMAC chromatography as demonstrated with commercial preparations

  • Size exclusion chromatography to ensure monodispersity

  • For membrane-associated domains, detergent screening is critical (DDM, LMNG, GDN, etc.)

  • Consider amphipol or nanodisc reconstitution for maintaining native-like membrane environment

• Quality control metrics:

  • Achieve >95% purity (compared to >80% for standard applications)

  • Verify protein folding using circular dichroism

  • Assess thermal stability using differential scanning fluorimetry

  • Confirm monodispersity via dynamic light scattering

• Buffer optimization:

  • Screen alternatives to the standard PBS with 1M Urea (pH 7.4)

  • Test stability in various buffer systems (HEPES, Tris, phosphate)

  • Optimize salt concentration and additives that enhance stability

Researchers should be aware that the transmembrane nature of PRRT1 presents particular challenges for structural biology approaches, and techniques optimized for membrane proteins should be employed for best results.

How can researchers effectively assess PRRT1 expression changes in neurological disorder models?

To effectively assess PRRT1 expression changes in neurological disorder models, researchers should implement a comprehensive, multi-modal approach:

• Transcriptional analysis:

  • Quantitative RT-PCR with carefully validated primers specific to PRRT1

  • RNA-sequencing for unbiased assessment of PRRT1 transcript levels alongside other genes

  • Single-cell RNA-sequencing to detect cell type-specific expression changes

  • Analysis of alternative splicing, which may be particularly relevant in neurological disorders

• Protein level assessment:

  • Western blotting with validated antibodies against PRRT1

  • Mass spectrometry-based proteomics for unbiased quantification

  • Proximity extension assays for sensitive detection in limited samples

  • Spatial proteomics to assess changes in subcellular distribution

• Histological approaches:

  • Immunohistochemistry in brain sections from disease models

  • Multiplex immunofluorescence to co-localize PRRT1 with cell-type markers and synaptic proteins

  • RNAscope for simultaneous detection of PRRT1 mRNA and protein

  • Quantitative image analysis for objective measurement across samples

• Functional correlates:

  • Electrophysiological recordings to correlate PRRT1 expression with synaptic strength

  • AMPA receptor trafficking assays, given PRRT1's role in AMPAR regulation

  • Behavioral assessments correlated with PRRT1 expression levels

• Statistical considerations:

  • Similar to epilepsy outcome studies where PRRT1 showed prognostic value (AUC=0.9415, p=0.0077) , employ robust statistical methods

  • Include adequate biological replicates (minimum n=6-8 per group)

  • Control for confounding variables (age, sex, genetic background)

  • Consider longitudinal analysis where possible

This multi-modal approach will provide comprehensive insights into how PRRT1 expression changes contribute to pathophysiology in neurological disorder models, potentially revealing therapeutic opportunities similar to those suggested in epilepsy research .

What techniques are most effective for studying the interaction between PRRT1 and AMPA receptors in living neurons?

Studying PRRT1-AMPA receptor interactions in living neurons requires specialized techniques that preserve the native environment while providing high temporal and spatial resolution. The following approaches are recommended:

• Advanced live imaging techniques:

  • Single-molecule tracking of fluorescently tagged PRRT1 and AMPAR subunits to monitor co-trafficking and co-localization in real-time

  • FRET (Förster Resonance Energy Transfer) or FLIM (Fluorescence Lifetime Imaging Microscopy) to detect direct protein-protein interactions with nanometer precision

  • Super-resolution microscopy (PALM, STORM) with live-cell compatible protocols for visualizing nanoscale organization at synapses

  • Lattice light-sheet microscopy for extended 3D imaging with reduced phototoxicity

• Functional interaction studies:

  • Optogenetic or chemogenetic manipulation of PRRT1 expression/function with simultaneous electrophysiological recording of AMPAR-mediated currents

  • Glutamate uncaging combined with calcium imaging to assess compartment-specific AMPAR function in relation to PRRT1

  • AMPAR surface expression assays using pH-sensitive fluorescent tags (pHluorin) in neurons with manipulated PRRT1 levels

• Proximity-based protein interaction detection:

  • Split fluorescent protein complementation (BiFC) between PRRT1 and AMPAR subunits

  • Enzymatic proximity labeling techniques adapted for live neurons (TurboID, APEX2)

  • Time-resolved protein interaction detection using light-inducible dimerization systems

• Genetic manipulation strategies:

  • Acute manipulation using viral-mediated CRISPR-Cas9 to modify PRRT1 in mature neurons

  • Inducible expression systems to control PRRT1 levels with temporal precision

  • Domain-specific mutations to map interaction interfaces while maintaining expression

• Physiological context considerations:

  • Perform studies during different forms of synaptic plasticity (LTP, LTD)

  • Assess interactions during development and in mature neurons

  • Examine changes during neuronal activity patterns that mimic in vivo conditions

These techniques will provide critical insights into how PRRT1 regulates AMPARs under basal conditions and during synaptic plasticity , advancing our understanding of excitatory neurotransmission mechanisms relevant to learning, memory, and neurological disorders.

What are the promising future research directions for PRRT1 in neuroscience and clinical applications?

Based on current knowledge of PRRT1 function and its clinical associations, several promising research directions emerge:

• Biomarker development for epilepsy: Building on the finding that lower PRRT1 expression levels predict better seizure outcomes after temporal lobectomy (AUC=0.9415) , researchers should develop non-invasive methods to assess PRRT1 expression or function. This could include:

  • Identifying peripheral biomarkers that correlate with brain PRRT1 expression

  • Developing imaging techniques that can detect PRRT1-related signatures

  • Creating predictive models combining PRRT1 data with other clinical parameters

• Therapeutic targeting:

  • Design small molecules or peptides that modulate PRRT1-AMPAR interactions

  • Explore gene therapy approaches to adjust PRRT1 expression in specific brain regions

  • Investigate whether existing anti-epileptic drugs affect PRRT1 function

• Expanded understanding of PRRT1 in synaptic function:

  • Map the complete interactome of PRRT1 at excitatory synapses

  • Determine how PRRT1 coordinates with other AMPAR regulatory proteins

  • Investigate PRRT1's potential roles in other forms of plasticity beyond LTP and LTD

• Neurological and psychiatric disorder relevance:

  • Systematically evaluate PRRT1 expression and function across brain disorders

  • Examine genetic variants in larger patient cohorts

  • Investigate potential connections between PRRT1's synaptic and immune-related functions

• Technological innovation:

  • Develop improved tools for studying membrane proteins like PRRT1 in their native environment

  • Create better mouse models with conditional and cell-type specific PRRT1 manipulation

  • Advance structural biology approaches to determine PRRT1's three-dimensional structure

These research directions promise to expand our understanding of PRRT1's fundamental biology while simultaneously advancing potential clinical applications, particularly in epilepsy treatment and other neurological disorders where synaptic dysfunction plays a key role.