Recombinant Human Proline-rich transmembrane protein 2 (PRRT2)

Shipped with Ice Packs
In Stock

Description

Protein Composition and Domains

Human PRRT2 consists of several key structural elements with distinct functions. The protein contains two hydrophobic segments (TM1, amino acids 275–295; TM2, amino acids 324–344), a long and relatively unstructured N-terminal region (amino acids 1–274) that includes a proline-rich domain (amino acids 133–222), an intracellular loop (amino acids 296–323) connecting the two putative transmembrane regions, and a very short C-terminal end . The mouse PRRT2 ortholog shows remarkable similarity to the human protein, particularly in the C-terminus, with only minor differences in the N-terminal region .

Novel Membrane Topology

Recent investigations have revealed a surprising topology for PRRT2 that differs significantly from earlier predictions. Using a combination of live immunolabeling, immunogold electron microscopy, surface biotinylation, and computational modeling, researchers have demonstrated that PRRT2 is not a member of the Dispanin family as previously thought, but instead adopts a type II transmembrane configuration .

In this novel topology, only the second hydrophobic segment (TM2) truly spans the plasma membrane. The first hydrophobic segment (TM1) does not cross the membrane but instead associates with its internal surface, forming a distinctive helix-loop-helix structure. Most significantly, the large proline-rich N-terminal domain resides intracellularly rather than extracellularly, with only the short C-terminus exposed to the extracellular environment (designated as N cytoplasmic/C extracellular or N cyt/C exo topology) .

Expression and Synaptic Localization

PRRT2 is primarily expressed in the central nervous system, where it plays important roles in neuronal function . Its specific intracellular localization at presynaptic terminals suggests involvement in synaptic processes. The intracellular positioning of its N-terminal domain is particularly significant for its function, as this region contains domains that mediate protein-protein interactions critical for neuronal signaling .

Protein Interactions and Synaptic Function

PRRT2 has been shown to interact with the Src homology 3 domain-bearing protein Intersectin 1, an intracellular protein involved in synaptic vesicle cycling . This interaction, facilitated by PRRT2's intracellular N-terminal domain, provides strong evidence for PRRT2's role in synaptic vesicle dynamics. The protein is thought to be involved in the modulation of synaptic neurotransmitter release, contributing to the regulation of neuronal excitability .

The proline-rich domain in the N-terminal region likely serves as a platform for interactions with multiple synaptic proteins, positioning PRRT2 as a critical regulator of presynaptic function. Disruption of these interactions through mutations may underlie the neurological manifestations observed in PRRT2-associated disorders.

Spectrum of Paroxysmal Disorders

Mutations in the PRRT2 gene have been identified as the leading cause for a wide spectrum of paroxysmal neurological conditions . These disorders share common features of paroxysmal symptoms but differ in their specific manifestations, age of onset, and clinical course.

Table 1: Distribution of PRRT2-Related Disorders Based on Analysis of 1,444 Published Cases

DisorderPercentageNumber of Cases
Benign familial infantile epilepsy41.7%602
Paroxysmal kinesigenic dyskinesia38.7%560
Infantile convulsions and choreoathetosis14.3%~207*
Other PRRT2-associated conditions5.3%~75*

*Numbers approximated based on the percentage given in source

Mutation Types and Their Effects

The vast majority of PRRT2 mutations lead to protein truncation or complete absence of the protein, resulting in haploinsufficiency . The most frequent mutation is a recurrent frameshift in an unstable region of nine cytosines, leading to a premature stop codon (c.649–650insC > p.Arg217Profs*7) . Other mutations include nonsense mutations and frameshifts predominantly located in the N-terminal domain, with fewer mutations affecting the transmembrane domains or cytoplasmic loop .

Truncated PRRT2 proteins appear to undergo degradation through nonsense-mediated mRNA decay or protein degradation pathways, as evidenced by their lack of expression in cell lines . This loss of functional PRRT2 is thought to result in altered synaptic neurotransmitter release and dysregulated neuronal excitability, manifesting as the paroxysmal disorders observed clinically .

Genotype-Phenotype Correlations

Studies have revealed significant genotype-phenotype correlations in PRRT2-related disorders. Patients with PRRT2 mutations typically experience an earlier age of onset, more severe manifestations and attacks, delayed diagnosis, and more complicated forms of paroxysmal kinesigenic dyskinesia compared to patients without PRRT2 mutations .

Notably, patients with truncating PRRT2 variants tend to have bilateral attacks, suggesting more severe paroxysmal symptoms . The mean interval from symptom onset to diagnosis in patients with PRRT2 variants has been reported to be 7.94 years, with a longer delay in diagnosis for patients with PRRT2 variants compared to those without . This observation provides further insight into the relationship between specific mutation types and clinical manifestations, potentially guiding diagnostic and therapeutic approaches.

Table 2: Characteristics of PRRT2 Variants and Their Clinical Effects

Variant TypeExamplesProtein EffectClinical Characteristics
Truncating variantsFrameshift: c.649dupC
Nonsense: c.649C>T
Splice site: c.879+5G>A
Truncated protein or no proteinEarlier onset
Bilateral attacks
More severe symptoms
Longer diagnostic delay
Non-truncating variantsMissense: c.856G>A
c.955G>T
c.884G>C
c.835C>T
c.902G>A
Altered protein functionLess severe phenotype
Often located at C-terminus
May affect plasma membrane targeting

Expression Systems and Challenges

As a transmembrane protein with a complex topology, recombinant production of PRRT2 presents significant challenges. The unique structure of PRRT2, with its helix-loop-helix TM1 domain and single membrane-spanning segment, requires careful consideration in designing expression systems that preserve the protein's native conformation and function.

Experimental approaches used to characterize PRRT2 have employed various tagged constructs, such as HA-tagged variants at the N-terminus (HA-PRRT2), C-terminus (PRRT2-HA), or within the loop connecting the two putative transmembrane segments (PRRT2-loop-HA) . Additionally, PRRT2 fused with turbo-GFP at the C-terminal (PRRT2-tGFP) has been successfully expressed in cell lines for immunodetection studies . These approaches demonstrate the feasibility of generating functional recombinant PRRT2 for research applications.

Research Applications

Recombinant PRRT2 serves as a powerful tool for investigating the structure, function, and pathophysiological mechanisms of this protein. Key research applications include:

  1. Structural studies: Recombinant PRRT2 enables high-resolution structural analysis through techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy.

  2. Interaction studies: Tagged recombinant PRRT2 facilitates the identification and characterization of protein binding partners, helping to elucidate the protein's role in synaptic function.

  3. Functional assays: Recombinant PRRT2 can be used in assays measuring neurotransmitter release, membrane trafficking, or other aspects of synaptic function.

  4. Antibody development: Purified recombinant PRRT2 serves as an antigen for generating specific antibodies useful in diagnostic and research applications.

  5. Mutation analysis: Expression of recombinant PRRT2 carrying disease-associated mutations allows direct comparison with wild-type protein to understand pathogenic mechanisms.

Therapeutic Potential

Given PRRT2's causal role in several neurological disorders, recombinant PRRT2 and related approaches hold significant therapeutic potential:

  1. Protein replacement strategies for cases of haploinsufficiency could theoretically restore normal PRRT2 levels and function.

  2. Development of small molecules that modulate PRRT2 function or stabilize mutant proteins might be facilitated by screening against recombinant PRRT2.

  3. Structural insights gained from studies with recombinant PRRT2 could guide rational drug design for targeted therapies.

  4. Recombinant PRRT2 could serve as a platform for developing novel diagnostic tools to identify patients with PRRT2-related disorders earlier, potentially improving treatment outcomes.

Expanding Knowledge of PRRT2 Biology

Current research on PRRT2 focuses on further characterizing its role in synaptic function and neuronal excitability. The novel topology revealed through recent studies has significant implications for understanding PRRT2's interactions and functions . The intracellular localization of the proline-rich N-terminal domain suggests this region participates in interactions with cytoplasmic proteins involved in synaptic vesicle dynamics and neurotransmitter release .

The discovery that PRRT2 interacts with Intersectin 1, a protein involved in synaptic vesicle cycling, provides an important clue to its function . Further research is needed to determine whether this interaction is direct or mediated by other proteins, and to identify additional components of the PRRT2 interactome.

Therapeutic Approaches for PRRT2-Related Disorders

Current treatment for PRRT2-related disorders primarily relies on anticonvulsant medications, with varying degrees of efficacy. Research has shown that patients with PRRT2 variants respond differently to treatment compared to those without such variants, highlighting the importance of genetic diagnosis for tailoring therapeutic approaches .

The development of more targeted therapies based on a deeper understanding of PRRT2 function represents an important direction for future research. Given that most pathogenic mutations result in haploinsufficiency, approaches aimed at increasing expression from the remaining wild-type allele or stabilizing mutant PRRT2 proteins hold promise.

Future Technological Advances

Advances in protein engineering, structural biology, and gene therapy are likely to accelerate progress in PRRT2 research and therapeutic development. Improved methods for membrane protein expression and purification will facilitate more detailed structural studies of recombinant PRRT2. Meanwhile, gene editing technologies such as CRISPR-Cas9 offer potential approaches for correcting PRRT2 mutations in affected cells.

The continued characterization of PRRT2 function and the development of more sophisticated recombinant expression systems will undoubtedly lead to new insights and therapeutic opportunities for PRRT2-related disorders in the coming years.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRRT2; Proline-rich transmembrane protein 2; Dispanin subfamily B member 3; DSPB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PRRT2
Target Protein Sequence
MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVD SGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATA DQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK
Uniprot No.

Target Background

Function
As a component of the AMPAR complex's outer core, PRRT2 might be involved in synaptic transmission within the central nervous system. In presynaptic terminals of hippocampal neurons, it plays a crucial role in the final stages of neurotransmitter release, potentially by regulating Ca(2+)-sensing. In the cerebellum, PRRT2 may inhibit SNARE complex formation and downregulate short-term facilitation.
Gene References Into Functions
  1. This study indicated no substantial difference in the age at onset between PKD patients with (n = 27) and without (n = 46) PRRT2 mutations. PMID: 29285950
  2. miR-30b promotes glioblastoma cell proliferation, migration, and invasion by targeting PRRT2. PMID: 28550683
  3. This research identified PRRT2 and DAB2IP as frequently mutated in various cancer cell line types. Further analysis revealed that both genes were also frequently mutated in colorectal and endometrial cancer patient samples. Functional studies indicated that PRRT2 is implicated in cellular proliferation and migration, with the truncated microsatellite instability-derived PRRT2 form promoting both processes. PMID: 27907910
  4. The expression level of PRRT2 was significantly higher in the human brain compared to other human tissues, providing experimental evidence for a potential link between PRRT2 and neurogenesis. To the best of our knowledge, this study is the first to report the expression pattern of PRRT2 in human tissues. PMID: 27449084
  5. PRRT2 mutations have roles in neuronal dysfunction and neurodevelopmental defects. PMID: 27172900
  6. The cases reported in this study constitute the first genetically confirmed series of paroxysmal kinesigenic dyskinesia (PKD) in Hong Kong. Screening for the PRRT2 c.649dupC mutation is recommended for all patients with all forms of PKD. PMID: 27920401
  7. Data show that proline-rich transmembrane protein 2 (PRRT2) is decreased in glioma and is targeted by microRNA miR-30a-5p. PMID: 28192116
  8. These findings indicate a novel role for zinc regulation in the PKCalpha/beta-catenin pathway and explain an important mechanism for controlling the stem cell program in lung cancer cells. PMID: 28122729
  9. PRRT2 mutations are most likely not associated with benign epilepsy with centrotemporal spikes in the Chinese mainland population. PMID: 26954261
  10. Exome sequencing was conducted, and a duplication mutation c.649dupC (p.R217Pfs*8) in the proline-rich transmembrane protein 2 gene (PRRT2) was identified in patients with febrile seizures. PMID: 25502464
  11. In this study, 20 probands with BPEI were negative for a family history of BPEI and negative for PRRT2 mutations. PMID: 26561923
  12. We found three new mutations in PRRT2 in patients with Paroxysmal Kinesigenic Dyskinesia: c.insT27 p.Ser9*, c.G967A p.Gly323Arg, and c.delCA215_216 p.Thr72Argfs*62. PMID: 26384010
  13. A novel intronic PRRT2 mutation causes paroxysmal kinesigenic dyskinesia with infantile convulsions. PMID: 26936445
  14. This study provides a comprehensive review of PRRT2-associated diseases. PMID: 26598493
  15. This study highlights the frequency, novel mutations, and clinical and molecular spectrum of PRRT2, SLC2A1, and PNKD mutations, as well as the phenotype-genotype overlap among these paroxysmal movement disorders. PMID: 26598494
  16. The 649dupC frameshift mutation of the PRRT2 gene is associated with paroxysmal kinesigenic dyskinesia. PMID: 26829736
  17. Mutant PRRT2, possibly through its weakened interaction with SNAP25, affects glutamate signaling and glutamate receptor activity, leading to an increase in glutamate release and subsequent neuronal hyperexcitability. PMID: 25915028
  18. PRRT2 mutations are common in patients with paroxysmal kinesigenic dyskinesia (PKD) and are linked to an earlier age at onset, longer attack durations, combined phenotypes of dystonia and chorea, and a tendency for a family history of PKD. PMID: 26446061
  19. This research investigated the sequences of PRRT2 and CLCN1 in a proband diagnosed with paroxysmal kinesigenic dyskinesia and suspected myotonia congenita; the proband and his father carried a PRRT2 c.649dupC mutation, and CLCN1 c.1723C>T and c.2492A>G mutations; this is the first report demonstrating the coexistence of PRRT2 and CLCN1 mutations. PMID: 25205014
  20. This study examined the phenotypic spectrum of biallelic mutations. PMID: 25595153
  21. The results of this study suggest that the NMD of truncated mutations in PRRT2 and altered cellular localization of undegraded PRRT2 might lead to Paroxysmal Kinesigenic. PMID: 25457817
  22. PRRT2 variants were likely involved in the etiology of febrile seizures in epileptic patients. PMID: 25522171
  23. A novel PRRT2 mutation was found in patients with benign familial infantile seizures. PMID: 25060993
  24. This study describes the broad clinical spectrum associated with PRRT2 mutations and presents current hypotheses regarding the underlying pathophysiology [review]. PMID: 25194488
  25. PRRT2 is the causative gene for infantile convulsions with paroxysmal choreoathetosis, and the mutation c.649_650insC was the hotspot for PRRT2 mutations. PMID: 25449067
  26. Data suggest that proline-rich transmembrane protein 2 (PRRT2) is the causative gene for paroxysmal kinesigenic dyskinesias, benign familial infantile seizures, convulsions with choreoathetosis, and suggest naming them as PRRT2-related paroxysmal disorders. PMID: 25297589
  27. Two novel mutations in PRRT2 were identified in paroxysmal dyskinesia and choreoathetosis syndrome. PMID: 24609974
  28. The results do not support a role for PRRT2 coding sequence variants in ASD but provide an ascertainment of its genetic variability in worldwide populations that should help researchers and clinicians better investigate the role of PRRT2 in human diseases. PMID: 24594579
  29. This study indicated that positivity for PRRT2 mutations is a predictor of younger age of onset and more frequent attacks in PKD patients. PMID: 24661410
  30. Our findings demonstrated that the c.186-187delGC mutation resulted in a truncated protein from the PRRT2 gene to be involved in paroxysmal kinesigenic dyskinesia pathogenesis with haploinsufficiency. PMID: 25027704
  31. This study confirms that PRRT2 mutations are common in paroxysmal kinesigenic dyskinesia with the first double PRRT2 mutation reported. PMID: 23551744
  32. PRRT2 is a common causative gene for patients with paroxysmal kinesigenic dyskinesia from Southwest China. PMID: 23496026
  33. PRRT2 is the major causative gene for benign familial infantile epilepsy and infantile convulsions with paroxysmal choreoathetosis in Chinese families. PMID: 24370076
  34. In this family, benign familial infantile seizures (BFIS) are caused by a PRRT2 mutation, and hemiplegic migraine by p.Arg689Gln ATPase ATP1A2 mutation. PMID: 24928127
  35. Compared to controls, patients with the p.P217fsX7 mutation showed increased amplitude of low-frequency fluctuation in the right postcentral gyrus. This might reflect the distinct pathological mechanism resulting from PRRT2 mutation. PMID: 23532549
  36. Mutation analysis of PRRT2 has identified the c.649-650insC mutation in all BFIS patients. PMID: 23896529
  37. We identified PRRT2 as the main causative gene for paroxysmal kinesigenic dyskinesia among the Taiwanese population. PMID: 23436308
  38. PRRT2 mutations do not appear to be involved in the etiology of FS or infantile epileptic encephalopathies. PMID: 24101679
  39. We describe a family with characteristic Paroxysmal dyskinesia and a nonsense PRRT2 mutation. PMID: 22902309
  40. Our study revealed that PRRT2 mutations are common in Japanese patients with benign infantile epilepsy, particularly in patients with a family history of paroxysmal kinesigenic dyskinesia. PMID: 23131349
  41. Each rare copy number variation (CNV) is unique to one specific patient, except for the PRRT2-containing 16p11.2 microduplication, illustrating the high level of genomic heterogeneity in rolandic epilepsy. PMID: 24372385
  42. This study further supports the notion that PRRT2 is the primary causative gene for Parkinson's disease in the Chinese population. PMID: 23456995
  43. The identification of heterozygous mutations in the PRRT2 gene in paroxysmal kinesigenic dyskinesia, as well as in benign familial infantile seizures, linked episodic movement disorders with epilepsy. PMID: 23963607
  44. This review describes numerous paroxysmal disorders and their link to PRRT2 mutations. PMID: 23398397
  45. The coexistence of paroxysmal kinesigenic dyskinesia and hemiplegic migraine is reported in twins harboring a heterozygous mutation in PRRT2. PMID: 23182655
  46. This study showed that 5 variants in the PRRT2 gene were found in 20 paroxysmal kinesigenic dyskinesia pedigrees. PMID: 23529024
  47. This study showed that in one paroxysmal kinesigenic dyskinesia family with infantile seizures, mutations were exclusively found in two exons of the PRRT2 gene. PMID: 23299620
  48. This is a review on the role of PRRT2 in benign familial infantile epilepsy, infantile convulsions with choreoathetosis syndrome, and paroxysmal kinesigenic dyskinesia. PMID: 23343561
  49. This study expands the clinical spectrum related to PRRT2 mutations and underscores the complexity of the phenotypic consequences of mutations in this gene. PMID: 23352743
  50. The results confirm that a PRRT2 mutation is a hotspot mutation leading to benign infantile epilepsy or infantile convulsions with choreoathetosis syndrome, regardless of ethnic background. PMID: 23073245

Show More

Hide All

Database Links

HGNC: 30500

OMIM: 128200

KEGG: hsa:112476

STRING: 9606.ENSP00000351608

UniGene: Hs.655071

Involvement In Disease
Episodic kinesigenic dyskinesia 1 (EKD1); Convulsions, familial infantile, with paroxysmal choreoathetosis (ICCA); Seizures, benign familial infantile, 2 (BFIS2)
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Single-pass membrane protein. Cell junction, synapse. Cell projection, axon. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, postsynaptic density membrane. Cell projection, dendritic spine.

Q&A

What is the confirmed membrane topology of PRRT2?

PRRT2 exhibits a novel membrane topology that differs significantly from predictions based on the Dispanin family classification. Through multiple experimental approaches including live immunolabeling, immunogold electron microscopy, and surface biotinylation, researchers have demonstrated that PRRT2 is a type II transmembrane protein with an Ncyt/Cexo orientation. Specifically:

  • Only the second hydrophobic segment (TM2) spans the plasma membrane

  • The first hydrophobic segment (TM1) associates with the internal surface of the membrane in a helix-loop-helix structure without crossing it

  • The large proline-rich N-terminal domain is localized intracellularly

  • Only the short C-terminus is exposed to the extracellular environment

This topology was verified through experiments with HA-tagged PRRT2 constructs at different positions (N-terminus, C-terminus, and connecting loop), where only C-terminally tagged PRRT2 was detected during live cell immunolabeling .

How does PRRT2 function at the synapse?

PRRT2 plays multiple roles in synaptic function:

  • Presynaptic function: PRRT2 interacts with Src homology 3 (SH3) domain-bearing proteins like Intersectin 1, which is involved in synaptic vesicle cycling . The proline-rich N-terminal domain of PRRT2 contains multiple consensus sequences for SH3 domain binding.

  • Neurotransmitter release regulation: In hippocampal neurons, PRRT2 is important in the final steps of neurotransmitter release, possibly through regulation of Ca²⁺-sensing .

  • SNARE complex modulation: In the cerebellum, PRRT2 may inhibit SNARE complex formation and down-regulate short-term facilitation .

  • AMPA receptor interaction: PRRT2 functions as a component of the outer core of the AMPAR complex and specifically binds to GluA1, suggesting involvement in glutamatergic synaptic transmission .

This multi-faceted synaptic role explains why PRRT2 mutations can lead to various paroxysmal disorders characterized by altered neuronal excitability.

What protein interactions of PRRT2 have been experimentally confirmed?

Several key protein interactions have been validated through various experimental approaches:

Protein PartnerExperimental MethodFunctional Significance
SNAP25Pull-down assaysPRRT2 interacts with this synaptic t-SNARE protein, suggesting a role in synaptic vesicle docking and neurotransmitter release
Intersectin 1Co-immunoprecipitationStrongest interaction among tested SH3 domain-bearing proteins; important for synaptic vesicle cycling
GluA1Not specified in resultsPRRT2 specifically binds to GluA1 AMPA receptor subunit, potentially modulating glutamatergic transmission
Endophilin 1Pull-down assays (SH3 domain)Strong interaction in vitro, but failed to co-immunoprecipitate with full-length protein

These interactions support PRRT2's role in synaptic transmission and neurotransmitter release regulation, explaining why mutations lead to paroxysmal neurological disorders.

What is the spectrum of PRRT2-associated disorders?

PRRT2 mutations are associated with a wide spectrum of paroxysmal disorders:

  • Epilepsy phenotypes:

    • Benign familial infantile seizures (BFIS)

    • Benign familial infantile epilepsy (BFIE)

    • Self-limited familial neonatal-infantile epilepsy

  • Movement disorders:

    • Paroxysmal kinesigenic dyskinesia (PKD)

    • Paroxysmal kinesigenic choreoathetosis

  • Combined phenotypes:

    • Infantile convulsions and choreoathetosis (ICCA) syndrome

  • Other neurological manifestations:

    • Migraine

    • Hemiplegic migraine

    • Intellectual disability

The age-dependent expression pattern of PRRT2 may explain why some phenotypes (like seizures) manifest in infancy while others (like movement disorders) appear later in life. This clinically heterogeneous presentation from the same genetic mutation represents an important research area for understanding age-dependent neurological manifestations .

How do PRRT2 mutations affect protein function and localization?

PRRT2 mutations impact protein function through several mechanisms:

  • Expression level effects:

    • Many mutations (particularly in the C-terminal region) result in dramatically reduced protein expression

    • The common c.649dupC mutation leads to mRNA degradation through nonsense-mediated decay, causing haploinsufficiency

  • Subcellular localization changes:

    • Wild-type PRRT2 predominantly localizes to the plasma membrane

    • Many mutant forms lose membrane targeting and remain in the cytoplasm

    • In functional studies, 13 missense variants showed altered subcellular localization

  • Combined effects:

    • Ten variants affect both protein expression and membrane localization

    • Three variants only affect membrane localization

    • Two variants only affect protein expression

This provides evidence that the C-terminal region of PRRT2, which contains the transmembrane domains, is crucial for proper localization and function, explaining why mutations in this region are more likely to be pathogenic .

What experimental approaches are effective for studying PRRT2 membrane topology?

To accurately determine PRRT2's membrane topology, researchers employed multiple complementary techniques:

  • Live immunolabeling:

    • Generation of differentially tagged constructs (HA-PRRT2, PRRT2-HA, PRRT2-loop-HA)

    • Comparison of antibody accessibility under permeabilizing vs. non-permeabilizing conditions

    • This revealed that only C-terminal epitopes were accessible without membrane permeabilization

  • Immunogold electron microscopy:

    • Both pre-embedding and post-embedding techniques

    • Visualizes precise localization of N-terminal and C-terminal domains on opposite sides of the plasma membrane

    • Quantification showed C-terminus was almost entirely extracellular while N-terminus was predominantly cytosolic

  • Structural modeling and molecular dynamics (MD) simulations:

    • Generation of all-atom structural models using Rosetta software

    • Simulations in water-membrane model environment (POPC lipids)

    • 20-50 ns trajectories to validate structural stability

    • Root mean square displacement analysis showing model stability

Combining these approaches provides comprehensive evidence for PRRT2's novel type II transmembrane topology, contradicting earlier predictions based solely on sequence homology.

What are the optimal methods for functionally characterizing PRRT2 variants?

For comprehensive characterization of PRRT2 variants, researchers should employ a multi-method approach:

  • Expression vector construction:

    • Site-directed mutagenesis to generate variant constructs

    • N-terminal EGFP-tagged PRRT2 constructs for localization studies

    • HA/FLAG-tagged constructs for Western blot detection

    • Complete sequencing of entire coding region to confirm mutations

  • Protein expression analysis:

    • Western blotting to quantify expression levels

    • Comparison to wild-type PRRT2 under identical conditions

    • Assessment of protein stability and degradation

  • Subcellular localization studies:

    • Live cell confocal microscopy with GFP-tagged constructs

    • Comparison of membrane vs. cytoplasmic distribution

    • Co-localization with membrane markers

  • Protein-protein interaction studies:

    • Pull-down assays with GST-fusion proteins containing SH3 domains

    • Co-immunoprecipitation with known interacting partners (e.g., Intersectin 1)

    • Assessment of variant effects on binding capacity

  • Pathogenicity classification:

    • Application of ACMG guidelines for variant classification

    • Integration of functional data with clinical correlation

    • Computational prediction tools like CADD (Combined Annotation Dependent Depletion)

This comprehensive approach enables researchers to classify variants as likely pathogenic, likely benign, or of uncertain significance, providing crucial information for clinical interpretation.

What are the critical factors for successful expression and purification of recombinant PRRT2?

Successful expression and purification of recombinant PRRT2 requires careful consideration of several factors:

  • Expression system selection:

    • E. coli is the most commonly used expression system for N-terminal domain fragments (amino acids 1-268)

    • Full-length protein may require eukaryotic expression systems due to transmembrane domains

  • Purification considerations:

    • His-tagged constructs allow for efficient purification

    • N-terminal tagging is preferred since the C-terminus contains transmembrane domains

    • Typical purification yields >85% purity as determined by SDS-PAGE

  • Buffer optimization:

    • Tris/PBS-based buffers with pH 8.0

    • Addition of 6% trehalose improves stability

    • For storage, 5-50% glycerol (typically 50%) is recommended

  • Storage conditions:

    • Store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Brief centrifugation before opening vials

    • Reconstitute lyophilized protein in deionized sterile water

    • Target concentration of 0.1-1.0 mg/mL

Following these guidelines will help ensure consistent experimental results when working with recombinant PRRT2 protein.

How can computational modeling enhance understanding of PRRT2 structure-function relationships?

Computational modeling provides valuable insights into PRRT2 structure and function:

  • Structural prediction and refinement:

    • The Rosetta online software can generate all-atom structural models of PRRT2's transmembrane domains

    • Models can be assessed using quality metrics like normalized Qmean scores and Z-scores

    • This approach revealed key features like the helix-loop-helix motif in TM1

  • Molecular dynamics simulations:

    • All-atom MD simulations in water-membrane environments (POPC lipids)

    • Trajectories of 20-50 ns to validate structural stability

    • Analysis of root mean square displacement and native contacts fraction

  • Mutation impact assessment:

    • Combined Annotation Dependent Depletion (CADD) tool for scoring mutation deleteriousness

    • Can distinguish between likely pathogenic and benign variants

    • Most PRRT2 mutations score >15 on CADD, with transmembrane domain mutations scoring 22.80-33.00

  • Domain function prediction:

    • Computational analysis can identify binding motifs such as SH3-binding proline-rich sequences

    • Modeling can reveal how TM domains interact with membrane bilayers

    • Helps explain why missense mutations cluster in transmembrane domains

These computational approaches complement experimental studies and can guide hypothesis formation, especially for predicting impacts of novel variants and understanding molecular mechanisms of disease-causing mutations.

What are the current knowledge gaps in PRRT2 research?

Despite significant advances, several important questions about PRRT2 remain unanswered:

  • Precise molecular mechanisms:

    • Exactly how PRRT2 regulates synaptic transmission remains incompletely understood

    • The specific mechanism by which PRRT2 modulates Ca²⁺-sensing needs further investigation

    • How PRRT2 interacts with the AMPA receptor complex requires additional study

  • Age-dependent phenotype expression:

    • The mechanisms underlying age-dependent manifestations (seizures in infants vs. movement disorders in adults) are not fully explained

    • How temporal expression patterns of PRRT2 and interacting proteins influence disease phenotypes requires clarification

  • Variant classification challenges:

    • Eight PRRT2 variants remain classified as "uncertain significance"

    • Additional functional studies are needed to resolve their pathogenicity

  • Therapeutic implications:

    • How understanding PRRT2 function can translate to targeted therapies is an emerging area

    • Potential for personalized medicine approaches based on specific variants

Addressing these knowledge gaps will enhance our understanding of PRRT2 biology and could lead to improved diagnosis and treatment of associated disorders.

What novel methodologies show promise for advancing PRRT2 research?

Several innovative approaches hold potential for advancing PRRT2 research:

  • CRISPR-Cas9 genome editing:

    • Generation of precise disease models in cells and animals

    • Creation of isogenic cell lines with specific PRRT2 variants

    • sgRNA targeting specific coding regions (e.g., exon 2) has been developed

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize PRRT2 localization at synapses

    • Live-cell imaging to study dynamics of PRRT2 during synaptic activity

    • Correlative light and electron microscopy for nanoscale localization

  • Integrated omics approaches:

    • Proteomics to identify complete interactome of PRRT2

    • Transcriptomics to understand temporal expression patterns

    • Combination with computational modeling for systems biology perspective

  • Improved variant classification:

    • Development of high-throughput functional assays

    • Integration of multiple data types for more accurate pathogenicity prediction

    • Application of machine learning to predict variant effects

These emerging methodologies promise to deepen our understanding of PRRT2 biology and pathology, potentially leading to new diagnostic and therapeutic approaches for PRRT2-associated neurological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.