Recombinant Human Prostaglandin D2 receptor 2 (PTGDR2)

Shipped with Ice Packs
In Stock

Description

Signaling Pathways and Functional Roles

PTGDR2 couples primarily to Gαi/o proteins, triggering downstream cascades that regulate immune cell activity and inflammation .

Key Signaling Mechanisms

  1. cAMP Modulation: PGD2 binding inhibits adenylyl cyclase, reducing intracellular cAMP levels .

  2. Calcium Mobilization: Activates phospholipase C (PLC), generating inositol triphosphate (IP3) and diacylglycerol (DAG), which elevate cytosolic Ca²⁺ .

  3. Autophagy Regulation: In gastric cancer stem cells (GCSCs), PTGDR2 activation by PGD2 induces autophagy via ATG4B stabilization, reducing stemness .

PathwayEffectCellular OutcomeReferences
Gαi/o → cAMP inhibition↓ cAMP, ↑ Ca²⁺Chemotaxis, degranulation
PLC → IP3/DAG↑ Ca²⁺, PKC activationCell migration, granule release
RNF5/ATG4B interaction↓ ATG4B ubiquitination↑ Autophagy, apoptosis

Allergy and Asthma

PTGDR2 is a therapeutic target for allergic diseases due to its role in Th2-driven inflammation:

  • Chemotaxis: Mediates migration of eosinophils, basophils, and Th2 cells to inflammatory sites .

  • Antagonist Efficacy: DP2 antagonists (e.g., timapiprant) reduce airway inflammation in asthma models .

  • Biomarker Potential: Elevated PTGDR2 expression in peripheral blood correlates with asthma severity .

Cancer

PGD2/PTGDR2 signaling inhibits gastric cancer progression:

  • Stemness Suppression: PGD2 decreases GCSC viability, invasion, and stemness markers (CD44, OCT4) .

  • Autophagy Activation: PTGDR2 knockdown reverses PGD2-induced autophagy, enhancing tumor growth .

DiseasePTGDR2 RoleTherapeutic TargetReferences
AsthmaAmplifies Th2 cytokine release, eosinophil recruitmentAntagonists (timapiprant, BAY-u3405)
Gastric CancerInhibits GCSC self-renewal via autophagy inductionAgonists (PGD2)
Alzheimer’s DiseaseDP2 antagonists reduce neuroinflammation and cognitive deficitsTimapiprant

Recombinant PTGDR2

Recombinant PTGDR2 is utilized in studies to dissect receptor-ligand interactions and signaling:

  • Expression Systems: HEK293 cells, lentiviral vectors .

  • Binding Assays: High-affinity PGD2 binding (Kd: 2.5–109 nM), distinct from DP1 receptors .

ApplicationMethodologyKey FindingsReferences
Ligand ScreeningRadioligand binding (e.g., [³H]PGD2)PGD2 > 13,14-dihydro-PGD2 > PGJ2
Signaling StudiescAMP assays, Ca²⁺ imagingGαi/o-dependent cAMP inhibition
Cancer Stem Cell ModelsSphere-forming assays, xenograftsPTGDR2 knockdown reverses PGD2 effects

Future Directions and Challenges

  1. Therapeutic Development:

    • DP2 Antagonists: Testing in neurodegenerative diseases (e.g., Alzheimer’s) .

    • PGD2 Mimetics: Exploring anti-tumor efficacy in gastric cancer .

  2. Mechanistic Insights:

    • Cross-Talk with Other Pathways: Interactions with RNF5/ATG4B in autophagy .

    • Tissue-Specific Roles: Divergent functions in allergy vs. fibrosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PTGDR2; CRTH2; DL1R; GPR44; Prostaglandin D2 receptor 2; Chemoattractant receptor-homologous molecule expressed on Th2 cells; G-protein coupled receptor 44; CD antigen CD294
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Uniprot No.

Target Background

Function
Prostaglandin D2 receptor 2 (PTGDR2) is a receptor for prostaglandin D2 (PGD2). It is coupled to the G(i)-protein. Receptor activation can lead to pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also involved in mediating PTGDR2 effects. PGD2 induces receptor internalization. CRTH2 internalization can be regulated by various kinases, including PKC, PKA, GRK2, GPRK5/GRK5, and GRK6. Receptor activation plays a role in immune regulation and allergic/inflammation responses.
Gene References Into Functions
  1. Research indicates that CRTh2 expression is regulated through the competitive actions of GATA3 and NFAT1. PMID: 29969451
  2. Individuals with severe Hashimoto disease exhibit higher frequencies of the AA genotype for the CRTH2 rs545659 SNP and the CC genotype and C allele for the CRTH2 rs634681 SNP compared to those with mild Hashimoto disease. PMID: 29848886
  3. This study employed the GEnSeMBLE complete sampling with hierarchical scoring (CS-HS) methodology to predict 3D structures for the DP prostaglandin GPCR. PMID: 29268008
  4. The study reports CRTh2 expression on vascular pericytes in the central nervous system and gastric mucosa. PMID: 27103662
  5. CRTH2 mediates most prostaglandin D2 pro-inflammatory effects, and the long receptor residence time of antagonist LAS191859 translates into long-lasting in vivo efficacy. PMID: 27317944
  6. CRTH2 plays a pro-inflammatory role in TNBS-induced colitis and Crohn's disease. Eosinophils contribute to the severity of the inflammation, which is improved by a selective CRTH2 antagonist. Crohn's disease patients exhibit increased serum levels of PGD2 and Delta(12)-PGJ2 compared to control individuals. PMID: 26928963
  7. This study shows that allergic rhinitis patients exhibit increased amounts of VIP and PGD2 in their nasal secretions during the early phase reaction; however, CRTH2 gene expression from leukocytes recovered in their nasal secretions is upregulated only during the late phase reaction. PMID: 28222358
  8. CRTH2 expression on thyroid-infiltrating lymphocytes as well as on lymphocytes from peripheral blood is increased in Hashimoto's thyroiditis compared to controls. PMID: 27872865
  9. A smaller proportion of group 2 innate lymphoid cells isolated from nondiseased human lung expressed CRTH2. PMID: 25850654
  10. Patients with chronic spontaneous urticaria exhibit altered expression of chemoattractant CRTH2 on blood basophils and eosinophils. PMID: 26194547
  11. Hypermethylation of specific markers (MAL, PRIMA1, PTGDR, and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer. PMID: 26482433
  12. In ulcerative colitis, DP2 receptor shows higher expression in neutrophils but lower in monocytes, while CRTH2 receptor is decreased in eosinophils, NK, and CD3(+) T cells but not in monocytes and CD3(+)/CD4(+) T cells. PMID: 24929001
  13. Low DP2 prostanoid receptor is associated with gastric cancer progression. PMID: 24922638
  14. The CRTH2 rs533116 SNP was associated with allergic asthma in White individuals. PMID: 22947041
  15. CRTH2 is not expressed on human amniocytes or myocytes and plays no role in the mechanism of 15dPGJ2-mediated inhibition of NF-kappaB. PMID: 23226366
  16. Confocal images and FACS demonstrated a strong association and co-localization between VIP peptide and CRTH2 molecules. PMID: 23168411
  17. These data show that prostaglandin D(2) induces human osteoclast apoptosis through activation of CRTH2 and the apoptosis intrinsic pathway. PMID: 22705147
  18. Research suggests that CRTH2+ CD4+ T cells may be involved in the enhanced Th2 cell-mediated immunity in IgG4-related lacrimal gland enlargement. PMID: 22627365
  19. This study identified PGH(1) as an important lipid intermediate and novel CRTH2 agonist, which may trigger CRTH2 activation in vivo in the absence of functional prostaglandin D synthase. PMID: 22442685
  20. This study provides the first clinical evidence that CRTH2 receptors contribute to airflow limitation, symptoms, and eosinophilic airway inflammation in asthma. PMID: 21762224
  21. DP receptors amplify the biological response to CRTH2 activation, and the CRTH2/DP heteromer might represent both a functional signaling unit for PGD(2) and a potential target for developing heteromer-directed therapy for allergic diseases. PMID: 21930295
  22. Higher frequencies of the TT genotype of CRTH2 -466T>C were observed in aspirin-exacerbated respiratory disease patients compared to aspirin-tolerant asthma patients. PMID: 22101342
  23. Expression defines IL-25- and IL-33-responsive type 2 innate lymphoid cells. PMID: 21909091
  24. DP mediates eosinophils through the elevation of intracellular cAMP production but does not change CRTH2 expression. The balance between DP and CRTH2 could influence the degree of PGD2-induced eosinophil migration. PMID: 21624751
  25. DK-PGD-induced CLC/Gal-10 mRNA level can serve as a potential marker for monitoring pharmacodynamic effects of blood exposure to CRTH2 modulating agents. PMID: 20858065
  26. In immunologically activated nasal polyp tissue, PGD(2) produced by mast cells promotes the migration of Th2 cells through a CRTH2-dependent mechanism. PMID: 19839971
  27. The CRTH2 -466T>C gene polymorphism increases serum and cellular eotaxin-2 production through lowered CRTH2 expression. PMID: 19796209
  28. CRTH2 was significantly enriched on interleukin (IL)-4+/IL-13+ T cells compared to interferon (IFN)-gamma+ T cells. There were more CRTH2+ T cells in the bronchoalveolar lavage (BAL) of asthmatics vs. controls. PMID: 20491797
  29. CRTH2 is GPR44, a G protein-coupled receptor 44. Characterization of C-terminal tail determinants involved in CRTH2 receptor trafficking identified a recycling motif. PMID: 20035740
  30. Indomethacin may exert its therapeutic effect in eosinophilic pustular folliculitis (Ofuji's disease) by reducing CRTH2 expression, as well as by inhibiting PGD2 synthesis. PMID: 20107720
  31. CRTH2 is involved in mediating some of the therapeutic and/or unwanted side effects of indomethacin, independently of cyclooxygenases and peroxisome proliferator-activated receptors. PMID: 11801628
  32. Association of a new-type prostaglandin D2 receptor CRTH2 with circulating T helper 2 cells in patients with atopic dermatitis. PMID: 12230502
  33. Data show that 11-dehydro-thromboxane B(2) is a full agonist of the chemoattractant receptor-homologous molecule expressed on TH2 cells(CRTH2) receptor and hence might cause CRTH2 activation in cellular contexts. PMID: 14668348
  34. This review discusses CRTH2 protein structure and expression. PMID: 15065763
  35. Sequence variants of CRTH2 are associated with asthma and differentially influence mRNA stability. PMID: 15345705
  36. Restoration of CRTH2/CCR3 expression may be an indicator of optimal recovery after septic shock. PMID: 15507393
  37. This research examined the selective effect of other PGD2 metabolites on CRTH2. PMID: 15789622
  38. This study analyzed determinants of ligand binding affinity and selectivity for prostaglandin D2 receptor CRTH2. PMID: 16030019
  39. Data show that the prostaglandin PGD(2) metabolite, 9alpha,11beta-PGF(2), and its stereoisomer, PGF(2alpha), are CRTH2 chemoattractant receptor agonists. PMID: 16378605
  40. PGD(2) exerts its effects partly through CRTH2. The PGD(2)/CRTH2 system mediates the chemotaxis of eosinophils, basophils, & Th2 cells involved in the induction of allergic inflammation. Human bronchial epithelial cells express CRTH2. PMID: 17541272
  41. These data further emphasize the importance of CRTH2 in eosinophil function (recruitment, respiratory burst, and granulation). PMID: 17714552
  42. D-type prostanoid (DP) receptors comediate with CRTH2 the mobilization of eosinophils from bone marrow and their chemotaxis, which might provide the rationale for DP antagonists in the treatment of allergic disease. PMID: 17878378
  43. The study demonstrated GATA-3 binding to a probe from the CRTh2 promoter. PMID: 17910949
  44. This research investigated the relationship between G1544C and A1651G SNPs and serum IL-13 levels in Chinese children patients with asthma. PMID: 18777142
  45. These results suggest that expression of DP and CRTH2 is associated with the pathophysiology of chronic rhinosinusitis, and the expression of these receptors may be regulated by h-PGDS and PGD. PMID: 18802357
  46. PGH2 causes activation of the PGD2 receptors CRTH2 and DP via a dual mechanism: by interacting directly with the receptors and/or by giving rise to PGD2 after catalytic conversion by plasma proteins. PMID: 18835884
  47. CRTH2 inhibition by its C terminus may represent a rather unappreciated strategy employed by a GPCR to specify the extent of G protein activation. PMID: 19010788
  48. CRTH2 expressions of leukocytes in allergic nasal mucosa are significantly up-regulated compared to those in nonallergic nasal mucosa, suggesting that CRTH2 may play an important role in the recruitment of leukocytes into allergic nasal mucosa. PMID: 19230460
  49. The CRTH2 -466T>C gene polymorphism may not affect the phenotype of chronic urticaria, but it contributes to the required dose of antihistamines in patients. PMID: 19290788
  50. Genetic variation within CRTh2 modifies the development of allergic sensitization and asthma in a population of German children. PMID: 19392992

Show More

Hide All

Database Links

HGNC: 4502

OMIM: 604837

KEGG: hsa:11251

STRING: 9606.ENSP00000332812

UniGene: Hs.299567

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widespread expression. High expression in stomach, small intestine, heart and thymus. Intermediate expression in colon, spinal cord and peripheral blood and low expression in brain, skeletal muscle and spleen. Expressed also on Th2- and Tc2- type cells, e

Q&A

What is the primary signaling mechanism of PTGDR2?

PTGDR2 (also known as CRTH2) primarily couples to the G-protein Gαi/o, as demonstrated through functional studies using recombinant PTGDR2 expressed in HEK293(EBNA) cells. Activation of PTGDR2 by PGD2 results in a decrease of intracellular cAMP in a pertussis toxin-sensitive manner, confirming the Gαi/o-coupled mechanism . This distinguishes PTGDR2 from the DP1 receptor (PTGDR1), which primarily couples to Gαs and increases cAMP levels upon activation. Methodologically, this signaling mechanism can be verified through cAMP assays after stimulation with PGD2 and related metabolites, with response inhibited by pertussis toxin pretreatment .

What is the tissue distribution pattern of PTGDR2 expression?

While initially identified in hematopoietic cells, Northern blot analysis has revealed that PTGDR2 is expressed in multiple tissues throughout the body. Expression has been detected in brain, heart, thymus, spleen, and various tissues of the digestive system . Additionally, in situ hybridization studies have confirmed PTGDR2 mRNA expression in human eosinophils, and radioligand binding studies have demonstrated endogenous PTGDR2 expression in eosinophilic cell lines, including butyric acid-differentiated HL-60 and AML 14.3D10 . For researchers, tissue distribution analysis should include both transcript-level assessment (qPCR, Northern blot) and protein-level confirmation (immunohistochemistry, Western blot) to fully characterize PTGDR2 expression patterns.

How does the binding affinity of PGD2 and its metabolites differ between PTGDR2 and PTGDR1?

Equilibrium competition binding assays have revealed distinct affinity profiles between PTGDR2 and PTGDR1. For PTGDR2, the rank order of binding potency is: PGD2 > 13,14-dihydro-15-keto PGD2 > 15-deoxy-Δ12,14-PGJ2 > PGJ2 > Δ12-PGJ2 > 15(S)-15 methyl-PGD2, with Ki values ranging from 2.4 to 34.0 nM . This contrasts significantly with PTGDR1, where the binding potency follows: PGD2 > PGJ2 > Δ12-PGJ2 > 15-deoxy-Δ12,14-PGJ2 >>> 13,14-dihydro-15-keto-PGD2 .

Notably, PGD2 demonstrates higher affinity for PTGDR1 than for PTGDR2, with saturation analysis revealing that the affinity of PGD2 for CRTH2 is eight times less than its affinity for the DP receptor . Methodologically, researchers should use radioligand binding assays with appropriate controls when studying ligand-receptor interactions, as receptor expression levels can influence apparent binding affinities.

How does the PGD2/PTGDR2 signaling pathway affect cancer stem cell regulation?

The PGD2/PTGDR2 signaling pathway plays a crucial role in restricting the self-renewal of cancer stem cells (CSCs), particularly in gastric cancer. Mechanistic studies have revealed that PGD2 inhibits STAT3 phosphorylation and nuclear expression, which is essential for CSC maintenance . Specifically, the inhibitory effect of PGD2 on the expression of CSC markers disappears after mutations are introduced into the STAT3 phosphorylation (Thr705) site .

In experimental models, knocking down L-PTGDS (PGD2 synthase) and PTGDR2 expression in CSC-like cells enhances the expression of CSC markers and increases self-renewal ability. Conversely, direct PGD2 stimulation and L-PTGDS overexpression produce the opposite effect, reducing stemness and self-renewal capacity . The expression of L-PTGDS and PTGDR2 is negatively correlated with gastric cancer CSC markers Sall4 and Lgr5 in gastric cancer tissues .

For researchers investigating this pathway, sphere formation assays and in vivo limiting dilution assays are recommended methodological approaches to assess CSC self-renewal capacity following manipulation of the PGD2/PTGDR2 axis.

What is the potential of PTGDR2 expression as a biomarker in asthma and related conditions?

Transcriptomic analysis has identified PTGDR2 as one of the most differentially overexpressed genes in peripheral blood of asthmatic patients (p-value 2.64 × 10^-6) . This finding has been validated through qPCR studies, where PTGDR2 transcripts were significantly upregulated in asthmatic patients (p < 0.001) .

The upregulation of PTGDR2 is particularly prominent in specific asthma subgroups:

  • Allergic asthma

  • Asthma with chronic rhinosinusitis with nasal polyposis (CRSwNP)

  • Aspirin-exacerbated respiratory disease (AERD)

  • Eosinophilic asthma

  • Severe persistent asthma

For clinical research applications, PTGDR2 expression analysis should follow MIQE guidelines, including appropriate reference gene selection (e.g., GAPDH or TBP) and efficiency testing (optimal values between 90% and 102%) . ROC curve analysis has demonstrated that PTGDR2 expression levels can effectively differentiate between asthmatic and non-asthmatic subjects, suggesting potential utility as a minimally invasive biomarker for adult asthma molecular phenotyping .

How does PTGDR2 expression correlate with eosinophil counts in different asthma subtypes?

While PTGDR2 expression correlates with eosinophil counts in peripheral blood, this relationship shows distinct patterns across different asthma subtypes. In some subgroups of asthmatic patients, PTGDR2 expression provides additional information beyond what can be determined from blood eosinophil counts alone . This suggests that PTGDR2 expression may reflect aspects of disease pathophysiology that are not captured by standard eosinophil enumeration.

For researchers investigating biomarkers, it is important to note that PTGDR2 remains differentially expressed even after adjusting expression levels through logistic regression with blood cell counts . This indicates that PTGDR2 expression is not merely a proxy for eosinophilia but represents a distinct molecular signature in asthmatic conditions.

Methodologically, multivariate regression analysis adjusting for potential confounding variables (age, sex, IgE, and white blood cell counts) should be employed when analyzing PTGDR2 expression data in relation to eosinophil counts .

What are the sex-specific differences in PTGDR2 signaling and expression?

Sex-specific differences in prostaglandin signaling have been observed in several studies. In particular, the expression of PTGDS (Prostaglandin D synthase) has been found to be upregulated in female dorsal root ganglion (DRG) neurons compared to male neurons . Female mice also exhibit higher levels of PTGDS protein and PGD2 production .

Interestingly, PTGDS blockade produces more intense grimacing in male compared to female mice, suggesting that endogenous PGD2 might reduce nociception in the absence of injury in a sex-dependent manner . Additionally, female mice display more mechanical allodynia and grimacing after PGE2 injection than male mice, further highlighting sex differences in prostaglandin responses .

For researchers investigating sex differences:

  • Statistical analysis should account for unequal variances between groups (e.g., using Welch's correction with t-tests)

  • Include appropriate age matching and consider hormonal status (e.g., exclude post-menopausal samples when investigating reproductive hormone effects)

  • Analyze large neuron populations for statistical power (e.g., the cited study analyzed 6,813 neurons: 2,920 from female DRG samples and 3,893 from male DRG samples)

What methodologies are most effective for studying PTGDR2 expression in clinical samples?

For reliable quantification of PTGDR2 expression in clinical samples, quantitative PCR (qPCR) with appropriate reference genes is the most widely validated approach. The methodology should include:

  • RNA extraction with quality control (RNA integrity number assessment)

  • Reverse transcription using standardized protocols

  • qPCR using SYBR Green or probe-based assays with efficiency testing (acceptable range: 90-102%)

  • Reference gene validation (e.g., GAPDH and TBP have shown similar PTGDR2 relative expressions with high correlation: Spearman ρ, 0.783; p < 0.001)

  • Triplicate technical replicates with appropriate non-template controls and calibrators

  • Data analysis using the 2^(-ΔΔCt) comparative method

To rule out intra-patient variability, PTGDR2 measurements should be performed twice over time in a subset of subjects . All procedures should follow MIQE guidelines to ensure reproducibility and reliability of results.

How might PTGDR2 antagonists be utilized in precision medicine approaches?

Given the upregulation of PTGDR2 in specific asthma subtypes, measuring PTGDR2 expression levels in peripheral blood might assist in selecting patients most likely to respond to PTGDR2 antagonists . This represents a precision medicine approach that could improve treatment outcomes by targeting therapies to the most appropriate patient populations.

The methodology for implementing such an approach would involve:

  • Establishing standardized PTGDR2 expression assays suitable for clinical laboratories

  • Determining appropriate cutoff values through ROC curve analysis

  • Validating the predictive value of PTGDR2 expression for treatment response in prospective clinical trials

  • Integrating PTGDR2 expression testing into asthma management algorithms

What experimental models are optimal for studying PTGDR2 in cancer research?

Based on the available research, several experimental models have proven effective for studying PTGDR2 in cancer:

  • In vitro models:

    • CSC-like cell populations derived from gastric cancer cell lines

    • Sphere formation assays to assess self-renewal capacity

    • Gene knockdown/overexpression systems to manipulate PTGDR2 and L-PTGDS expression

  • In vivo models:

    • Subcutaneous tumor models to assess growth inhibition

    • Peritoneal metastasis models to evaluate effects on liver and mesenteric metastasis

For mechanistic studies, analyzing STAT3 phosphorylation and nuclear translocation following PGD2 treatment provides insights into downstream signaling events. Site-directed mutagenesis of the STAT3 phosphorylation site (Thr705) can be used to confirm the requirement of this residue for PGD2/PTGDR2-mediated effects on CSC marker expression .

Additionally, correlative studies examining the expression of L-PTGDS, PTGDR2, and CSC markers (e.g., Sall4, Lgr5) in patient-derived tumor samples can provide clinically relevant insights into the role of this pathway in human cancer.

What is the relationship between PTGDR2 expression and disease prognosis?

Studies have shown that PGD2 synthase (L-PTGDS) and PTGDR2 expression are lower in gastric cancer tissues than in adjacent normal tissues, and this reduced expression is associated with patient prognosis . The negative correlation between L-PTGDS/PTGDR2 expression and cancer stem cell markers (Sall4 and Lgr5) further suggests a potential prognostic value of PTGDR2 pathway components .

For researchers investigating prognostic biomarkers, methodology should include:

  • Large patient cohorts with comprehensive clinical data and adequate follow-up duration

  • Multivariate analysis adjusting for established prognostic factors

  • Both transcript-level (qPCR, RNAseq) and protein-level (IHC, Western blot) assessment

  • Evaluation in independent validation cohorts

What are the optimal conditions for expressing and purifying recombinant human PTGDR2?

For successful expression and purification of recombinant human PTGDR2, researchers should consider:

  • Expression system selection:

    • HEK293(EBNA) cells have been successfully used for functional PTGDR2 expression

    • Mammalian expression systems are generally preferred over bacterial systems for maintaining proper folding and post-translational modifications

  • Construct design:

    • Addition of purification tags (His, FLAG, etc.) at positions that do not interfere with ligand binding

    • Codon optimization for the chosen expression system

    • Signal sequence optimization for proper membrane targeting

  • Purification strategy:

    • Detergent solubilization optimization (type and concentration)

    • Two-step purification approach (e.g., affinity chromatography followed by size exclusion)

    • Quality control through SDS-PAGE, Western blot, and functional binding assays

  • Functional validation:

    • Radioligand binding assays to confirm proper folding and ligand recognition

    • cAMP inhibition assays to verify functional coupling to Gαi/o proteins

How can contradictions in PTGDR2 research findings be systematically addressed?

Contradictions in research findings are common in complex biological systems. For PTGDR2 research, systematic approaches to address contradictions include:

  • Methodological standardization:

    • Adopt consistent experimental protocols and reporting standards

    • Document detailed experimental conditions that might influence outcomes

  • Context consideration:

    • Sex differences may explain contradictory findings, as demonstrated in studies showing sex-specific effects of PGD2 signaling

    • Cell type-specific responses should be considered, as PTGDR2 is expressed in multiple cell types with potentially different signaling outcomes

  • Integrated analysis:

    • Meta-analysis of multiple studies to identify consistent patterns

    • Correlation of in vitro findings with in vivo and clinical observations

  • Mechanistic investigation:

    • Detailed signaling pathway analysis to identify context-dependent branch points

    • Consideration of receptor heterodimers or cross-talk with other signaling pathways

For experimental pain studies that have produced contradictory findings regarding prostaglandin signaling, sex-aware data analysis has revealed important differences that may explain discrepancies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.