Recombinant Human Prostaglandin D2 receptor (PTGDR)

Shipped with Ice Packs
In Stock

Description

Signaling Pathways

PTGDR activation triggers distinct pathways depending on receptor subtype:

  • PTGDR1 (DP1): Stimulates Gₐs, increasing cAMP and activating Protein Kinase A (PKA) .

  • PTGDR2 (DP2/CRTH2): Couples with Gₐi, reducing cAMP and elevating intracellular calcium via inositol phosphate .

These pathways mediate divergent effects:

  • Anti-inflammatory (PTGDR1): Inhibits dendritic cell migration and eosinophil apoptosis .

  • Pro-inflammatory (PTGDR2): Activates Tₕ2 cells and eosinophils, exacerbating asthma .

Role in Disease Pathogenesis

  • Asthma: PTGDR2 amplifies airway inflammation via type 2 cytokines (e.g., IL-4, IL-5) . Knockout studies in mice show reduced asthmatic responses .

  • Alzheimer’s Disease: PTGDR2 inhibition by timapiprant reduced Aβ plaques and cognitive deficits in TgF344-AD rats .

  • Lupus: Bispecific antagonist AMG853 (targeting PTGDR1/2) attenuated nephritis and autoantibody production in Lyn⁻/⁻ mice .

Table 2: Key Research Outcomes

Disease ModelInterventionOutcomeSource
Murine LupusAMG853 (DP1/DP2 antagonist)Reduced renal inflammation, anti-dsDNA antibodies
TgF344-AD RatsTimapiprant (DP2 antagonist)Mitigated Aβ pathology, improved cognition
Allergic AsthmaPTGDR knockdownDecreased IL-4, IL-6, and eosinophil infiltration

Therapeutic Applications

  • Antagonist Development: DP2 antagonists (e.g., timapiprant) are in clinical trials for asthma and Alzheimer’s .

  • Antibody Production: Recombinant PTGDR is used to generate monoclonal antibodies for research and diagnostic assays .

Expression and Purification

Recombinant PTGDR is expressed in E. coli or wheat germ systems with His tags for affinity chromatography . Key parameters include:

  • Purity: >90% by SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose .

Clinical and Experimental Relevance

  • Biomarker Potential: PTGDR expression correlates with Th2 cytokine production in allergic asthma .

  • Neurodegeneration: PTGDR2 activation in dopaminergic neurons exacerbates Parkinson’s-like pathology in mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PTGDR; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PTGDR
Target Protein Sequence
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Uniprot No.

Target Background

Function
The prostaglandin D2 receptor (PTGDR) is a receptor for prostaglandin D2 (PGD2). Its activity is primarily mediated by G(s) proteins, stimulating adenylate cyclase and increasing intracellular cAMP. Calcium mobilization is also observed, independently of inositol 1,4,5-trisphosphate formation. PTGDR is involved in PLA2G3-dependent mast cell maturation. Immature mast cells secrete PLA2G3, which acts on fibroblasts to synthesize PGD2, promoting mast cell maturation and degranulation via PTGDR.
Gene References Into Functions
  1. PGD2 signaling via the DP1 receptor is crucial for optimal microglia/macrophage activation and IFN expression following neurotropic coronavirus infection. PMID: 28630327
  2. PTGDR gene polymorphisms influence basal promoter activity, gene expression, and cytokine secretion patterns. PMID: 29088248
  3. Single nucleotide polymorphisms (SNPs) in PTGFR and SLCO2A1 genes correlate with latanoprost response in Han Chinese glaucoma patients, suggesting a role in determining treatment efficacy. PMID: 27336732
  4. EP2 receptors exhibit greater ligand selectivity (PGD2, PGE2, PGF2alpha) compared to DP receptors. PMID: 27636113
  5. PGD2 exacerbates disease activity by enhancing proinflammatory macrophage actions and subsequent neutrophil activation. PMID: 26792210
  6. The DP1 receptor's role in rosacea is non-obligatory; laropiprant did not improve erythemato-telangiectatic rosacea symptoms compared to placebo. PMID: 25142778
  7. EP2 receptors demonstrate greater mutational constraint than DP receptors. PMID: 25681680
  8. Low DP1 receptor expression is associated with gastric cancer progression. PMID: 24922638
  9. Lipocalin-type PGD2 synthase (L-PGDS) interacts intracellularly with the DP1 receptor in an agonist-independent manner. PMID: 24493589
  10. The PTGDR -549 C/T polymorphism influences asthma susceptibility in European adults. No association was found for -441 C/T, -197 C/T polymorphisms or CCC/TCT haplotypes. PMID: 23192614
  11. Genetic variants may contribute to NSAID-induced acute urticaria. PMID: 23181793
  12. PGD2-DP signaling reduces vascular permeability via the endothelial cAMP/PKA/Tiam1/Rac1 pathway. PMID: 23307871
  13. The PTGDR -441C/T polymorphism is not associated with asthma or its phenotypes in North Indian populations. PMID: 22182808
  14. DP receptors amplify CRTH2 activation; the CRTH2/DP heteromer may represent a functional signaling unit and therapeutic target for allergic diseases. PMID: 21930295
  15. Genetic combinations impact PTGDR promoter activity by altering transcription factor affinity, defining different risk groups. PMID: 21883277
  16. PGD2 induces MUC5B overproduction via ERK MAPK/RSK1/CREB signaling; DP1 receptor may suppress MUC5B overproduction in the airway. PMID: 21832046
  17. PTGDR and LTC4S polymorphisms influence responsiveness to leukotriene receptor antagonists in Korean children with asthma. PMID: 21307858
  18. DP mediates eosinophil activation via intracellular cAMP increase, without affecting CRTH2 expression; the DP/CRTH2 balance may influence PGD2-induced eosinophil migration. PMID: 21624751
  19. During allergen-induced eosinophilic inflammation, cysteinyl-leukotriene production is regulated by DP1/DP2-orchestrated eosinophil activation. PMID: 20973774
  20. DP1 receptors (G(alphas)-coupled) increase adenylate cyclase activity and cAMP/PKA-dependent lipid body formation; DP2 receptors (G(alphai)-coupled) increase calcium; both signals are required for LTC(4) production. PMID: 21426314
  21. Prostanoid D2 receptor promoter haplotypes may contribute to a small but significant proportion of asthma risk in Caucasian populations. PMID: 21199159
  22. Mast cell-derived PGD2 controls hyaluronan synthesis in human orbital fibroblasts via DP1 activation; implications for thyroid eye disease. PMID: 20308056
  23. PTGDR polymorphisms are found in a subset of mothers with post-coital preterm births. PMID: 19710676
  24. New polymorphisms of the human prostanoid DP receptor gene are identified. PMID: 12002745
  25. Association of the CRTH2 receptor with circulating T helper 2 cells in atopic dermatitis patients. PMID: 12230502
  26. Amino acid sequence alignment of human, mouse, and rat DP receptors. PMID: 12895603
  27. DP1 receptor activation inhibits TNF-alpha-induced Langerhans cell migration from skin explants and chemotactic responses to CCL20 and CCL19. PMID: 15004188
  28. PTGDR is identified as an asthma-susceptibility gene. PMID: 15496624
  29. DP2 may play a critical role in allergic diseases. PMID: 15749909
  30. Prostanoid DP receptor activation on THP-1 cells enhances TNF-alpha-induced MCP-1 and IL-8 production via the cAMP/PKA pathway. PMID: 17307163
  31. Significant association between PTGDR polymorphisms and asthma phenotypes in Caucasian populations. PMID: 17538632
  32. Review: PGD2 effects are partly mediated by the D-prostanoid receptor; DP expression varies by tissue type and inflammatory status. PMID: 17541272
  33. Three PTGDR gene promoter polymorphisms are not major risk factors for asthma in the Chinese Han population. PMID: 17845306
  34. DP receptors co-mediate eosinophil mobilization from bone marrow and chemotaxis with CRTH2; DP antagonists may be relevant in treating allergic diseases. PMID: 17878378
  35. Review: DP1 activation may contribute to long-lasting blood flow changes in target organs. PMID: 17965752
  36. Expression of EP2, EP3, EP4, DP2, and TP receptors (and lesser EP1 expression) is observed in hair follicle compartments. PMID: 18005048
  37. Nasal polyp DP and CRTH2 expression correlates with chronic rhinosinusitis and bronchial asthma. PMID: 18797183
  38. DP and CRTH2 expression is associated with chronic rhinosinusitis pathophysiology, potentially regulated by h-PGDS and PGD2. PMID: 18802357
  39. PTGDR promoter polymorphism association in Spanish children with asthma. PMID: 18811623
  40. PGD2 induces HO-1 mRNA expression via the DP2 receptor, linking PGD2-DP2 signaling with heme homeostasis. PMID: 18957281
  41. PTGDR is not a major candidate gene for asthma or atopy in Chinese children. PMID: 19220773
Database Links

HGNC: 9591

OMIM: 604687

KEGG: hsa:5729

STRING: 9606.ENSP00000303424

UniGene: Hs.306831

Involvement In Disease
Asthma-related traits 1 (ASRT1)
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes.

Q&A

What is the Prostaglandin D2 receptor and what are its main subtypes?

The Prostaglandin D2 (PGD2) receptors are G protein-coupled receptors that bind and are activated by prostaglandin D2. Also known as PTGDR or DP receptors, they play important roles in various functions of the nervous system and inflammation. These receptors include two main subtypes:

  • Prostaglandin D2 receptor 1 (DP1) - encoded by the PTGDR1 gene

  • Prostaglandin D2 receptor 2 (DP2) - encoded by the PTGDR2 gene (also known as CRTH2)

The distinction between these subtypes is important as they have different signaling pathways, tissue distribution, and physiological functions, which significantly impacts experimental design and interpretation of results.

What is the genomic structure and protein characteristics of human PTGDR?

The PTGDR gene encoding the prostaglandin D2 receptor in humans is located on the long arm of chromosome 14 at position 14q22.1 and consists of four exons. Molecular cloning studies have revealed that the corresponding cDNA encodes a protein with 359 amino acids and a molecular mass of 40,276 daltons.

The receptor's structure features:

  • Seven rhodopsin-like transmembrane domains characteristic of G protein-coupled receptors

  • An extracellular NH2 terminus

  • An intracellular COOH terminus

  • Three possible sites for N-glycosylation at the Asn-10, Asn-90, and Asn-297 residues

  • Multiple phosphorylation sites for Protein kinase C (two in the first and second cytoplasmic loops and six in the COOH terminus)

This detailed structural knowledge is essential for designing experiments targeting specific domains or post-translational modifications of the receptor.

How do the signal transduction pathways differ between PTGDR subtypes?

The signaling pathways of the two PTGDR subtypes operate through different G protein coupling mechanisms:

DP1 (PTGDR1) Signaling:
The PGD2 receptor signaling pathway begins with prostaglandin D2 binding to the extracellular ligand site. This activates the Gs alpha subunit, which subsequently activates adenylate cyclase located on the cell membrane. Adenylate cyclase catalyzes the conversion of ATP to cyclic AMP (cAMP), resulting in elevated levels of this second messenger, which then triggers downstream cellular responses .

DP2/CRTH2 (PTGDR2) Signaling:
In contrast, the recombinant human CRTH2 receptor couples to Gi/o proteins, leading to a decrease in intracellular cAMP in a pertussis toxin-sensitive manner when activated by PGD2. This opposing effect on cAMP levels represents a fundamental difference in signaling mechanisms between the two receptor subtypes .

Understanding these distinct signaling pathways is crucial when designing pharmacological interventions or studying receptor-specific functions.

What tissues express PTGDR and how is this distribution significant for research?

PTGDR shows wide tissue distribution beyond the expected hematopoietic cells. Northern blot analysis has demonstrated PTGDR expression in:

  • Brain

  • Heart

  • Thymus

  • Spleen

  • Various tissues of the digestive system

  • Human eosinophils (confirmed by in situ hybridization)

Additionally, two eosinophilic cell lines (butyric acid-differentiated HL-60 and AML 14.3D10) endogenously express CRTH2. This widespread distribution suggests diverse physiological roles beyond inflammation and allergy, potentially including nervous system function, cardiac regulation, and digestive processes .

When designing experiments, researchers should consider this broad expression pattern, especially when studying tissue-specific functions or when using PTGDR as a potential therapeutic target.

How can PTGDR expression levels be reliably measured in clinical and research samples?

For accurate measurement of PTGDR expression levels, quantitative PCR (qPCR) following MIQE (Minimum Information for Publication of Quantitative Real-Time PCR Experiments) guidelines is recommended.

Methodological approach:

  • Extract RNA from whole blood or tissue samples

  • Perform reverse transcription to generate cDNA

  • Amplify PTGDR using validated primers (e.g., 5'-GGCATGAGGCCTAAAAATGAG-3' and 5'-CCTTGACATCCTTAAATGCTCC-3' for an 82-bp PTGDR fragment)

  • Normalize expression data to at least two housekeeping genes (e.g., GAPDH and TBP)

  • Verify primer efficiency and specificity

  • Confirm correlation between reference genes (e.g., Spearman ρ analysis)

This methodology has demonstrated significant differences in PTGDR expression between allergic patients and healthy controls, with a sensitivity of 81.4% compared to 67% for IgE levels, indicating its potential value as a biomarker .

What are the binding characteristics of PGD2 and related compounds to PTGDR subtypes?

Radioligand binding studies with recombinant human PTGDR have revealed complex binding properties:

Binding sites:

  • High affinity site: KD = 2.5 nM

  • Low affinity site: KD = 109 nM

Ligand selectivity for CRTH2 (DP2):
PGD2 and related metabolites bind with the following rank order of potency:

  • PGD2 > 13,14-dihydro-15-keto PGD2 > 15-deoxy-Δ12,14-PGJ2 > PGJ2 > Δ12-PGJ2 > 15(S)-15 methyl-PGD2

Ligand selectivity for DP1:
In contrast, DP1 shows a different binding profile:

  • PGD2 > PGJ2 > Δ12-PGJ2 > 15-deoxy-Δ12,14-PGJ2 >>> 13,14-dihydro-15-keto-PGD2

This differential binding profile has significant implications for selective targeting of either receptor subtype in research and potential therapeutic applications. When designing experiments involving PTGDR ligands, researchers should carefully select compounds based on their receptor subtype selectivity.

How should researchers design receptor binding assays for PTGDR?

For robust PTGDR binding assays, consider the following methodological approach:

  • Expression system selection:

    • HEK293(EBNA) cells have been successfully used for recombinant PTGDR expression

    • Alternatively, consider using eosinophilic cell lines that endogenously express CRTH2 (e.g., butyric acid-differentiated HL-60 or AML 14.3D10)

  • Radioligand selection:

    • Tritiated PGD2 is commonly used with appropriate specific activity

    • Consider cold competition assays with unlabeled ligands to determine relative binding affinities

  • Binding assay conditions:

    • Perform saturation binding to determine KD and Bmax values

    • Use equilibrium competition binding to determine Ki values for test compounds

    • Account for potential biphasic binding curves due to high and low affinity sites

  • Data analysis:

    • Apply appropriate mathematical models (one-site, two-site binding)

    • Calculate equilibrium dissociation constants (KD) and inhibition constants (Ki)

This methodological approach has successfully characterized the binding properties of multiple PGD2 metabolites to recombinant PTGDR .

Which PTGDR polymorphisms are most relevant to allergy research and how should they be genotyped?

Several promoter polymorphisms of PTGDR have been implicated in allergic diseases:

Key polymorphisms:

  • –1289G>A

  • –1122T>C

  • –881C>T

  • –834C>T

  • –613C>T

  • –549T>C

  • –441C>T

  • –197T>C

  • –95G>T

Of these, –1289G>A and –1122T>C show the strongest association with allergic conditions (P=.009). These polymorphisms are in strong linkage disequilibrium (coefficient=1, r²=0.985) .

Recommended genotyping methodology:

  • Extract DNA from whole blood using automated systems (e.g., MagNA Pure Compact System)

  • Amplify the PTGDR promoter region (1416-bp fragment) by PCR

  • Sequence the amplified fragments

  • Analyze genotype distributions and test for Hardy-Weinberg equilibrium

  • Perform haplotype analysis when appropriate

Researchers should particularly focus on –1289G>A and –1122T>C polymorphisms when investigating genetic associations with allergic diseases.

How do PTGDR polymorphisms affect receptor expression and function?

The relationship between PTGDR polymorphisms and receptor expression provides insight into the functional consequences of genetic variation:

Expression effects:
The mutant homozygous genotypes AA and CC of polymorphisms –1289G>A and –1122T>C, respectively, are associated with statistically significantly lower PTGDR expression levels (P=.034) .

This finding suggests these polymorphisms affect transcriptional regulation of the PTGDR gene, potentially through altered binding of transcription factors to the promoter region.

Functional implications:

  • Lower PTGDR expression may alter the sensitivity to PGD2 signaling

  • Changes in receptor levels could impact inflammatory and allergic responses

  • Polymorphism-associated expression differences may contribute to individual variability in disease susceptibility and treatment response

Researchers investigating PTGDR in allergic conditions should consider genotyping these key polymorphisms and correlating them with expression levels and clinical phenotypes.

How can PTGDR function be studied in cellular and animal models?

Cellular models:

  • Recombinant expression systems:

    • HEK293(EBNA) cells expressing human CRTH2 have been established for pharmacological studies

    • These systems allow for controlled expression levels and mutational analysis

  • Endogenous expression models:

    • Eosinophilic cell lines (butyric acid-differentiated HL-60, AML 14.3D10)

    • Primary human eosinophils (where CRTH2 mRNA expression has been confirmed)

Animal models:
DP receptor-deficient mice have provided valuable insights into PTGDR function in allergic asthma, demonstrating the involvement of the receptor in this condition .

Functional assays:

  • Signal transduction:

    • Measurement of cAMP levels (increased for DP1, decreased for DP2/CRTH2)

    • G-protein coupling (Gs for DP1, Gi/o for DP2/CRTH2)

    • Pertussis toxin sensitivity (for DP2/CRTH2)

  • Cell migration:

    • Chemotaxis assays to assess CRTH2-mediated cell migration in response to PGD2

    • Particularly relevant for studying eosinophil and Th2 lymphocyte recruitment

  • Inflammatory responses:

    • Measurement of cytokine production

    • Assessment of cellular infiltration in tissues

These methodological approaches provide a comprehensive framework for investigating PTGDR function across different experimental systems.

What are the experimental considerations when studying PTGDR as a therapeutic target?

When investigating PTGDR as a therapeutic target, researchers should consider:

Receptor specificity:

  • Clear distinction between DP1 and DP2/CRTH2 receptors is crucial

  • Compounds may interact with both receptors with different affinities

  • For example, nabilone targets both receptors with only slightly higher affinity for one, which may complicate data interpretation

Experimental design considerations:

  • Compound selectivity verification:

    • Evaluate binding affinities for both receptor subtypes

    • Confirm functional selectivity through appropriate signal transduction assays

  • Off-target effects:

    • Assess compound interaction with other prostaglandin receptors

    • Evaluate potential non-specific effects on other GPCRs

  • In vivo validation:

    • Use receptor knockout models to confirm target specificity

    • Consider compensatory mechanisms in chronic administration studies

  • Translational relevance:

    • Correlate findings with human genetic and expression data

    • Consider polymorphism-associated variability in drug response

Therapeutic potential context:
GPCRs represent important drug targets, with approximately 35% of approved drugs targeting these receptors . This highlights the potential of PTGDR as a therapeutic target, particularly in allergic and inflammatory conditions where its role has been established.

How can recombinant PTGDR be optimized for structural and functional studies?

Optimizing recombinant PTGDR for research applications requires consideration of several factors:

Expression system selection:

  • Mammalian systems:

    • HEK293(EBNA) cells have been successfully used for functional PTGDR expression

    • CHO cells provide an alternative platform with potential for higher expression

    • Consider tetracycline-inducible systems for controlled expression levels

  • Insect cell systems:

    • Baculovirus-infected Sf9 or High Five cells for higher protein yields

    • Suitable for structural studies requiring larger amounts of protein

Protein engineering strategies:

  • Fusion tags:

    • N-terminal tags (His, FLAG) for purification and detection

    • Consider the impact of tags on receptor function and ligand binding

  • Thermostabilizing mutations:

    • Introduction of specific mutations to enhance protein stability

    • Critical for crystallization and structural studies

  • Domain swapping:

    • Creation of chimeric receptors to study domain-specific functions

    • Useful for mapping ligand binding sites and G-protein coupling domains

Functional validation:

  • Confirm proper folding and trafficking to the plasma membrane

  • Verify ligand binding properties using radioligand binding assays

  • Assess G-protein coupling and downstream signaling

This methodological approach has been successful for structural and functional studies of other GPCRs and can be adapted for PTGDR research.

What are the latest techniques for studying PTGDR-mediated signaling in real-time?

Advanced methodologies for real-time assessment of PTGDR signaling include:

FRET/BRET-based approaches:

  • cAMP monitoring:

    • EPAC-based FRET sensors for real-time cAMP measurements

    • Particularly useful for distinguishing DP1 (cAMP increase) from DP2 (cAMP decrease) signaling

  • G-protein activation:

    • BRET-based assays measuring G-protein dissociation

    • Can distinguish between Gs (DP1) and Gi/o (DP2) coupling

Live-cell imaging techniques:

  • Receptor trafficking:

    • GFP-tagged receptors for visualizing internalization and recycling

    • Particularly relevant for understanding desensitization mechanisms

  • Calcium imaging:

    • Fluorescent calcium indicators for monitoring intracellular calcium flux

    • Important for secondary signaling events downstream of receptor activation

Single-molecule approaches:

  • Single-molecule FRET to study conformational changes upon ligand binding

  • Total internal reflection fluorescence (TIRF) microscopy for visualizing receptor dynamics at the membrane

Optogenetic tools:

  • Light-activated control of receptor signaling

  • Allows precise temporal and spatial control of receptor activation

These state-of-the-art methodologies enable detailed characterization of PTGDR signaling dynamics with unprecedented temporal and spatial resolution, providing deeper insights into receptor function.

How does PTGDR expression correlate with allergic phenotypes?

PTGDR expression shows significant correlation with allergic conditions:

Expression patterns in allergy:

  • PTGDR expression levels are significantly higher in allergic patients compared to healthy controls (P<.001)

  • This overexpression is observed across different allergic subgroups

Diagnostic value:

  • Receiver operating characteristic analysis for PTGDR expression showed 81.4% sensitivity as a biomarker for allergy

  • This compares favorably to IgE levels, which showed only 67% sensitivity

Expression-genotype relationships:

  • The mutant homozygous genotypes AA and CC of polymorphisms –1289G>A and –1122T>C are associated with lower PTGDR expression (P=.034)

  • These same polymorphisms show altered frequency in allergic patients (P=.009)

This data suggests PTGDR expression could serve as a valuable biomarker for allergic conditions, potentially with better performance than traditional markers like IgE. The correlation between specific genotypes and expression levels provides a mechanistic link between genetic variation and disease phenotype.

What methodological approaches can distinguish the roles of DP1 and DP2 in inflammatory responses?

To differentiate the roles of DP1 and DP2 in inflammation, consider these methodological approaches:

Pharmacological approaches:

  • Selective agonists and antagonists:

    • DP1-selective compounds: BW245C (agonist), MK-0524 (antagonist)

    • DP2-selective compounds: 15(R)-15-methyl PGD2 (agonist), CAY10471 (antagonist)

  • Metabolite profiling:

    • The metabolite 13,14-dihydro-15-keto PGD2 shows high affinity for DP2 but not DP1

    • This differential binding can be exploited to selectively activate DP2

Genetic approaches:

  • Receptor-specific knockout models:

    • DP-deficient mice have demonstrated the role of DP1 in allergic asthma

    • Separate DP1 and DP2 knockout models allow isolation of receptor-specific effects

  • siRNA-mediated knockdown:

    • Selective targeting of either receptor in cellular models

    • Useful for in vitro studies of inflammatory responses

Analytical techniques:

  • Flow cytometry:

    • Assessment of receptor expression on specific immune cell populations

    • Correlation with activation markers and cytokine production

  • Cell-specific responses:

    • DP2/CRTH2 mediates chemotaxis in T helper type 2 cells and eosinophils

    • DP1 has different effects on immune cell function

These methodological approaches provide a comprehensive toolkit for dissecting the distinct and sometimes opposing roles of DP1 and DP2 in inflammatory and allergic responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.