Recombinant Human Prostaglandin E2 receptor EP2 subtype (PTGER2)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant PTGER2 is expressed in heterologous systems to ensure high purity and functionality:

Expression SystemHostApplicationsPurityReference
Wheat germEukaryoticSDS-PAGE, ELISA, Western blot>90%
E. coliProkaryoticStructural studies, antibody production>97%
HEK293 cellsMammalianFunctional assays (cAMP, ligand binding)N/A

Key notes:

  • Wheat germ systems preserve eukaryotic folding but lack mammalian post-translational modifications .

  • E. coli-derived protein is cost-effective but may require refolding for functional studies .

Signaling Pathways

Recombinant PTGER2 activates the following pathways upon PGE2 binding:

  • Gsα-mediated cAMP/PKA: Increases intracellular cAMP, regulating smooth muscle relaxation and immune responses .

  • β-catenin/GSK-3β: Promotes cell migration and tumor progression .

  • PI3K/Akt: Enhances survival and metastasis in cancer cells .

Disease Associations

DiseaseRole of PTGER2Study Model
CancerPromotes angiogenesis, immune evasion, and metastasis via VEGF and Snail upregulation Colorectal, breast, and hepatocellular carcinoma models
NeuroinflammationExacerbates chronic neurotoxicity via cAMP/Epac pathways Murine epilepsy models
DiabetesProtects β-cells from streptozotocin-induced apoptosis via cAMP signaling PTGER2/PTGER4 agonist studies

Research Applications

Recombinant PTGER2 is utilized in:

  1. Ligand binding assays: To screen EP2-specific agonists (e.g., ONO-AE1-259-01) and antagonists (e.g., PF-04418948) .

  2. Drug discovery: Identified TG4-155 as a dual EP2/DP1 receptor antagonist for prostate cancer .

  3. Structural biology: Resolved cryo-EM structures to map allosteric modulator binding sites .

Key Research Findings

  • Cancer immunotherapy: PTGER2 knockout reduces tumor growth by restoring dendritic cell function .

  • Neuroprotection: EP2 activation shows acute neuroprotective effects in excitotoxicity models but worsens chronic inflammation .

  • Diabetes: PTGER2 agonists mitigate streptozotocin-induced hyperglycemia in mice .

Challenges and Future Directions

  • Specificity: Cross-reactivity with EP4 remains a concern due to overlapping Gsα signaling .

  • Therapeutic targeting: Dual EP2/EP4 inhibitors may enhance efficacy in cancer and inflammatory diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate them in the order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
PTGER2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Uniprot No.

Target Background

Function
Prostaglandin E2 receptor EP2 subtype (PTGER2) is a receptor for prostaglandin E2 (PGE2). Its activity is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent increase in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
Gene References Into Functions
  1. EP receptor levels were found to be elevated in human PASMCs and lung sections from PAH patients compared to controls. Therefore, EP receptors represent a potential therapeutic target for treprostinil, highlighting significant pharmacological differences between prostacyclin mimetics used in pulmonary arterial hypertension. PMID: 30103548
  2. PGE2 produced by mesenchymal stem cells contributes to the maintenance of self-renewal capacity through EP2 in an autocrine manner. PGE2 secretion is down-regulated by cell-to-cell contact. PMID: 27230257
  3. This study demonstrates that prostaglandin E2 inhibits human Treg cell differentiation via E prostanoid receptor 2-protein kinase A signaling. PMID: 28963072
  4. In breast cancer cells, overexpression of S1P3 and its activation by S1P exhibits pro-inflammatory and pro-metastatic potential by inducing COX-2 expression and PGE2 signaling via EP2 and EP4. PMID: 27616330
  5. EP2 and EP3 receptors are involved in tolerance induction through IL-10 production by tol-DCs. PMID: 28630103
  6. This is the first report that PGE2-induced uPAR expression, which stimulates invasiveness of human gastric cancer AGS cells, is mediated by the EP2 receptor-dependent Src/EGFR/JNK1/2, Erk1/2/AP-1, and Src/EGFR/JNK1/2, Erk1/2/NF-kappaB cascades. PMID: 27377703
  7. These results indicate that the ICL2 region of the EP2 receptor is its potential interaction site with Galphas, and that the aromatic side chain moiety at position 143 is a determinant for the accessibility of the ICL2 to the Galphas protein. PMID: 28336329
  8. EP2 receptor activation protects against endoplasmic reticulum stress-dependent mitochondrial apoptosis through down-regulation of p53. PMID: 27321910
  9. The expression of ERG in prostate cancer is linked to the expression of IL-6 mediated by the prostanoid receptor EP2. PMID: 27012192
  10. mPGES-1 is downregulated via EGR1 and plays a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes. PMID: 26538827
  11. Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production. PMID: 26560040
  12. Reduced EP2 receptor expression results in resistance to the antiproliferative effects of EP2 signaling in nasal polyp fibroblasts from subjects with AERD and supports a role for EP2 signaling in the aberrant growth of nasal polyp tissue. PMID: 26051534
  13. Intracellular EP2 prostanoid receptor promotes cancer-related phenotypes in PC3 prostate cancer cells. PMID: 25828575
  14. In adjusted models, gestations were 3.3 days longer (95%CI 0.6, 6.0) for each interquartile range of PTGER2 DNA methylation. PMID: 24827772
  15. Data show a protective role for the PGE2 receptors EP(2) and EP(4) following osmotic changes, through the reduction of human mast cell activity caused by calcium influx impairment and MAP kinase inhibition. PMID: 25329458
  16. Mediates the inhibitory effect of Prostaglandin E2 on nasal fibroblast migration. PMID: 24980222
  17. Overall, our results demonstrate that p53 is a negative regulator of aromatase in the breast and its inhibition by PGE2 provides a novel mechanism for aromatase regulation in obesity and breast cancer. PMID: 25634217
  18. PGE2 markedly enhanced Huh-7 cell invasion and migration ability by upregulating the expression level of Snail protein, and EP2 receptor played an important role in this process. PMID: 24626807
  19. Overexpression of EP2 was more observed in esophageal squamous cell carcinoma than in the control group. Overexpression of EP2 ESCC tissues might play a significant role in carcinogenesis and the progression of ESCC. PMID: 24883443
  20. EP2/cAMP/protein kinase A pathway mediates the stimulatory effect of PGEs on angiogenesis essential for tissue injury healing via the induction of CREB activity and VEGF expression. PMID: 25059824
  21. In Th17 cells, RORC repressed EP2 by directly silencing PTGER2 transcription, and knockdown of RORC restored EP2 expression in Th17 cells. PMID: 24812667
  22. The 15-PGDH gene is a MiTF-CX target gene in cervical stromal cells and is down-regulated by PGE2 through EP2 receptors. PMID: 24471568
  23. Human albumin solution infusions may be used to reduce circulating PGE2 levels, attenuating immune suppression and reducing the risk of infection in patients with acutely decompensated cirrhosis or ESLD. PMID: 24728410
  24. Cyclic tensile force activates ERK1/2 and p38 MAP kinase signaling pathways, and induces COX-2 expression, which is responsible for the sequential PGE2 biosynthesis and release, and mediates the increase in BMP-2 expression at the transcriptional level. PMID: 24561081
  25. Elastogenesis is spatially regulated by PGE-EP4 signaling in the ductus arteriosus. PMID: 24146253
  26. Although human lung mast cells may express both EP2 and EP4 receptors, the principal mechanism by which PGE2 inhibits mediator release in mast cells is by activating EP2 receptors. PMID: 23786281
  27. Data suggest that elevated PGE2 (prostaglandin E2) in the peri-implantation uterine lumen stimulates conceptus PTGER2 expression, which in turn promotes trophoblast adhesion via integrins and synthesis/secretion of embryonic signal estradiol-17. PMID: 23861370
  28. Loss of function of EP2- and EP4-mediated PGE2 signaling inhibits adhesion of human endometriotic epithelial and stromal cells through integrin-mediated mechanisms. PMID: 23242524
  29. PGE(2) coordinates control of IL-23 release in a dose-dependent manner by differential use of EP(2) and EP(4) receptors in LPS-activated MoDCs. PMID: 23337716
  30. The expression of the EP2 receptor and Bcl-2 was significantly increased. PMID: 23069790
  31. Targeted interference of EP2/EP4 signal to RalA.GTP may provide benefit to patients diagnosed with advanced kidney cancer. PMID: 22580611
  32. This review article presents a brief overview of experimental approaches aimed at manipulating signaling via EP2 and EP4 receptors, which could have therapeutic utility. PMID: 22706114
  33. HB9 binds to the prostaglandin E receptor 2 promoter and inhibits intracellular cAMP mobilization in leukemic cells. PMID: 23048027
  34. Although EP2 methylation status is inversely correlated to expression levels in established breast cancer cell lines, we could not identify such a correlation in tumor-associated stroma cells. PMID: 22929011
  35. Single nucleotide polymorphism in PTGER2 associated with multiple adenomas. PMID: 22551900
  36. Indomethacin has a potential antagonizing effect on human EP(2) receptors. PMID: 22329897
  37. Morin inhibited the production of NO and PGE(2). PMID: 22244821
  38. This study suggested that antipsychotics showing association with PGE2-mediated respons. PMID: 22099390
  39. EP2 receptor FuEP2/Ex2 may have a role in suppressing endometrial cancer cell growth. PMID: 21419570
  40. PGE2 induces IL-6 in orbital fibroblasts through EP2 receptors and increased gene promoter activity. PMID: 21209948
  41. Data show that inhibition of PGE2 receptors EP2 and EP4 suppresses expression and/or activity of MMP1, MMP2, MMP3, MMP7 and MMP9 proteins and increases expression of TIMP1, TIMP2, TIMP3, and TIMP4 proteins. PMID: 21111772
  42. Data suggest that early embryonic signals may regulate fetal-maternal crosstalk in the human endometrium by inducing CXCR4 expression via the PGE-PTGER2-mediated induction of the EGFR, PI3K and ERK1/2 pathways. PMID: 20705717
  43. Data demonstrate that down-regulation of PTGER2 and consequent PGE2 resistance are both mediated by DNA hypermethylation; increased Akt signal transduction is a novel mechanism that promotes DNA hypermethylation during fibrogenesis. PMID: 20889571
  44. miR-16 and miR-21 are directly regulated by the transcription factor NF-kappaB, and nicotine-promoted cell proliferation is mediated via EP2/4 receptors. PMID: 21081469
  45. Prostaglandin E2 receptor subtype EP2 and EP4 regulated gene expression profiling in ciliary smooth muscle cells. PMID: 20551148
  46. The mRNA levels of EP2 implicated pathways differed significantly in gliomas according to the histological type. PMID: 20382140
  47. E prostanoid (EP) 2 and EP3 have roles in cAMP/protein kinase A- and PI3-K/Akt-dependent NF-kappaB activation during shear-induced interleukin-6 synthesis in chondrocytes. PMID: 20516073
  48. Analysis of expression of serum vitamin D receptor, cyclooxygenase-2, and 15-hydroxyprostaglandin dehydrogenase in benign and malignant ovarian tissue and 25-hydroxycholecalciferol and prostaglandin E2 in ovarian cancer patients. PMID: 20304053
  49. EP1 and EP4 subtypes of prostaglandin E receptors (but not EP2 and EP3 receptors) may be involved in regulation of paracellular permeability in differentiated Caco-2 cell cultures. PMID: 20484658
  50. EP2 is a novel transcriptional target of Wnt3a in dermal papilla cells of human scalp hair follicles. PMID: 20347274

Show More

Hide All

Database Links

HGNC: 9594

OMIM: 176804

KEGG: hsa:5732

STRING: 9606.ENSP00000245457

UniGene: Hs.2090

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Placenta and lung.

Q&A

Where is PTGER2 expressed in the human body and how can this distribution be methodically studied?

PTGER2 demonstrates broad tissue distribution in humans, with notable expression in:

Tissue TypePTGER2 Expression
DigestiveSmall intestine
RespiratoryLung
ReproductiveUterus
ImmuneThymus
NeuralBrain cerebral cortex
SensoryCorneal epithelium

For methodical tissue distribution studies, researchers should employ multi-technique validation approaches including:

  • Immunohistochemistry with specific anti-PTGER2 antibodies, comparing expression to normal epithelial cells as a baseline control

  • Quantitative RT-PCR to measure mRNA expression levels across tissue panels

  • Western blot analysis with validated antibodies to detect protein expression

  • Single-cell RNA sequencing for cellular resolution of expression patterns

When conducting IHC studies, researchers should record the fraction of cells showing cytoplasmic PTGER2 overexpression compared to normal cells and establish appropriate cutoffs for positivity, potentially using microsatellite instability (MSI) status as a reference point .

What signaling pathways are activated by PTGER2 and how are they experimentally measured?

PTGER2 activation initiates a specific signaling cascade characterized by:

  • Coupling exclusively to Gαs proteins upon ligand binding

  • Stimulation of adenylyl cyclase activity

  • Increased intracellular cAMP production

  • Activation of downstream effectors regulated by cAMP

For experimental measurement of these pathways, researchers can employ:

  • ELISA-based cAMP quantification assays following PTGER2 activation

  • Fluorescent or luminescent cAMP reporter systems for real-time monitoring

  • Phosphorylation assays for downstream effectors such as PKA substrates

  • Calcium flux assays to distinguish PTGER2 from other EP receptors (PTGER2 activation typically doesn't induce calcium mobilization)

Unlike other prostaglandin receptors, PTGER2 is thought to alter cell function exclusively through cAMP generation , making this a critical endpoint for confirming selective receptor activation.

What is the experimental evidence for PTGER2's role in reproduction and fertility?

PTGER2 plays crucial roles in reproductive processes, particularly ovulation and fertilization. Multiple lines of experimental evidence support this:

  • Knockout mouse models demonstrate that mice lacking functional PTGER2:

    • Show modest reduction in ovulation capacity

    • Exhibit severely impaired fertilization capacity

    • Produce significantly reduced litter sizes

  • Mechanistic studies reveal that:

    • PGE2 acts as a key intrafollicular mediator of ovulation across mammalian species

    • The ovulatory LH surge regulates both PGE2 synthesis and PTGER2 expression

    • Different follicular cell types (oocyte, cumulus granulosa, mural granulosa, theca, endothelial) express distinct subsets of the four PTGERs, creating a spatial and temporal map of PGE2 responses

To study PTGER2's reproductive functions, researchers should consider:

  • Superovulation protocols in PTGER2-null vs. wild-type animals

  • In vitro fertilization assays using oocytes from PTGER2-deficient animals

  • Selective PTGER2 agonist (butaprost) administration timing experiments relative to the LH surge

  • Immunohistochemical mapping of receptor expression across follicular cell types during different stages of the ovulatory cycle

How does PTGER2 contribute to cancer development and progression?

PTGER2 has been implicated in multiple cancer types, acting as a potential tumor promoter:

  • Colorectal cancer studies show:

    • PTGER2 overexpression was detected in 33% (169/516) of colorectal cancer tumors by immunohistochemistry

    • PTGER2 upregulation is associated with inflammatory reactions in the carcinogenic process, particularly in microsatellite instability-high (MSI-high) colorectal cancer

  • PTGER2 knockout mouse models demonstrate:

    • Reduced incidence and progression of lung cancer

    • Diminished development of breast cancer

    • Decreased skin cancer occurrence

    • Lower rates of colon cancer

For investigating PTGER2 in cancer research, recommended methodologies include:

  • Multivariate logistic regression models to assess independent relationships between PTGER2 expression and other clinicopathological variables

  • Kaplan-Meier survival analysis and Cox proportional hazard models to evaluate the prognostic significance of PTGER2 overexpression

  • Stratified analysis by microsatellite instability status, LINE-1 methylation, and mutations in cancer-related genes (BRAF, KRAS, PIK3CA)

  • Statistical approaches that correct for multiple hypothesis testing (e.g., Bonferroni correction)

What methodological approaches can distinguish between PTGER2-specific effects and those mediated by other prostaglandin receptors?

Distinguishing PTGER2-specific effects requires carefully designed experimental approaches:

  • Pharmacological tools:

    • Selective PTGER2 agonists: Butaprost is highly selective for PTGER2 and serves as the gold standard agonist

    • PTGER2 antagonists: While AH6809 is commonly used, it has modest antagonist activity against PTGER1 and PTGER3 as well (limiting specificity)

    • Novel antagonists: PF-0441894 offers over 2000-fold selectivity for PTGER2 compared to other PTGERs and can block both native PGE2 and butaprost activation

  • Genetic approaches:

    • PTGER2 knockout models (global or conditional)

    • PTGER2 siRNA or shRNA knockdown

    • CRISPR/Cas9-mediated gene editing of PTGER2

    • Comparison with other PTGER knockout models (PTGER1, PTGER3, PTGER4)

  • Signaling pathway discrimination:

    • PTGER2 signals exclusively through cAMP, while other PTGERs use different second messengers

    • PTGER1 activation leads to calcium mobilization

    • PTGER3 typically inhibits adenylyl cyclase

    • PTGER4 increases cAMP (like PTGER2) but can also activate other pathways

Researchers should employ multiple approaches simultaneously for robust verification of PTGER2-specific effects.

What are the optimal conditions for working with recombinant PTGER2 protein in laboratory settings?

For optimal results with recombinant human PTGER2 protein:

  • Expression systems:

    • Wheat germ expression systems have proven effective for producing full-length (358 amino acid) functional PTGER2 protein

    • The protein is suitable for SDS-PAGE, ELISA, and Western blot applications

  • Storage and handling:

    • Store protein in buffer conditions that maintain the native conformation of the seven transmembrane domains

    • Avoid multiple freeze-thaw cycles which can compromise protein functionality

    • For experiments requiring membrane insertion, consider using liposome reconstitution methods

  • Experimental applications:

    • For functional assays, reconstitute in membrane environments or use cell systems expressing the recombinant protein

    • For binding studies, ensure proper folding of the ligand-binding domain

    • For antibody production, use highly purified protein with verified sequence integrity

  • Quality control measures:

    • Verify protein identity by mass spectrometry

    • Confirm ligand binding capacity with radiolabeled PGE2

    • Test functional activity through cAMP assays in appropriate cell systems

How should researchers design experiments to investigate PTGER2 expression patterns in pathological tissues?

For robust analysis of PTGER2 expression in pathological contexts:

  • Tissue preparation and sampling:

    • Use standardized fixation protocols (e.g., formalin fixation and paraffin embedding)

    • Include normal adjacent tissue as internal controls

    • Consider tissue microarrays for high-throughput analysis across multiple samples

  • Immunohistochemical detection:

    • Apply validated anti-PTGER2 antibodies with demonstrated specificity

    • Use rabbit secondary antibody, avidin-biotin complex conjugate, diaminobenzidine, and methyl-green counterstain

    • Maintain slides at 4°C overnight during primary antibody incubation

    • Record the fraction of tumor cells with cytoplasmic PTGER2 overexpression compared to normal colonic epithelial cells

  • Expression quantification:

    • Establish clear scoring criteria for PTGER2 positivity

    • Consider using microsatellite instability (MSI) status to determine appropriate cutoffs

    • Use digital image analysis when possible for objective quantification

    • Conduct statistical analysis comparing PTGER2 expression with clinicopathological variables

  • Validation approaches:

    • Confirm protein expression findings with mRNA analysis (RT-PCR or RNA-seq)

    • Cross-validate with multiple antibodies targeting different epitopes

    • Include positive and negative controls in each experimental batch

What statistical methods are most appropriate for analyzing PTGER2 expression in clinical samples?

For robust statistical analysis of PTGER2 expression data:

  • Descriptive statistics:

    • Clearly report the percentage of samples showing PTGER2 overexpression (e.g., 33% of colorectal tumors)

    • Use histograms or box plots to visualize expression distribution across sample groups

  • Correlation with categorical variables:

    • Apply chi-square tests to calculate odds ratios with 95% confidence intervals

    • For multiple hypothesis testing, adjust p-values using Bonferroni correction (e.g., p=0.0029 for 17 comparisons)

  • Multivariate analysis:

    • Construct multivariate logistic regression models to assess independent relations between PTGER2 expression and other variables

    • Include relevant covariates such as:

      • Demographic factors (sex, age, BMI)

      • Clinicopathological features (tumor location, grade, components)

      • Molecular characteristics (CIMP, MSI, mutations)

  • Survival analysis:

    • Use Kaplan-Meier method and log-rank test to assess survival time distribution by PTGER2 status

    • Construct multivariate, stage-matched Cox proportional hazard models

    • Verify the proportionality of hazard assumption by evaluating time-dependent variables

    • Assess interactions by including cross-product terms in multivariate models

  • Data imputation and missing values:

    • For missing categorical data, include cases in a majority category to avoid overfitting

    • Assign separate missing indicator variables to cases with missing information

    • Confirm that excluding cases with missing data doesn't substantially alter results

What are the most common pitfalls and challenges in PTGER2 research?

Researchers should be aware of several key challenges when studying PTGER2:

  • Receptor specificity issues:

    • PTGER2 shares 30% amino acid identity with PTGER4, potentially leading to misidentification in older literature

    • Many pharmacological tools lack sufficient selectivity (e.g., AH6809 has activity against PTGER1 and PTGER3)

    • Careful validation of receptor-specific effects is essential

  • Expression heterogeneity:

    • PTGER2 expression varies significantly across tissue types and disease states

    • Different cell types within the same tissue may express varying levels of PTGER2

    • Spatial and temporal expression patterns must be carefully mapped

  • Methodological limitations:

    • Lack of highly specific antibodies can hamper immunohistochemical studies

    • Global knockout models may not reveal tissue-specific functions

    • Compensatory mechanisms involving other EP receptors may confound results

  • Data interpretation challenges:

    • Conflicting results across different experimental models or species

    • Difficulty distinguishing primary from secondary effects of PTGER2 modulation

    • Translating findings from animal models to human physiology and pathology

  • Technical considerations:

    • Appropriate controls for receptor activation studies

    • Validation of knockdown or knockout efficiency

    • Careful selection of cell lines with appropriate prostaglandin receptor expression profiles

What emerging approaches might advance our understanding of PTGER2 biology?

Several promising research directions could significantly advance PTGER2 research:

  • Structural biology approaches:

    • Cryo-electron microscopy of PTGER2 in complex with ligands and G proteins

    • Structure-based design of more selective agonists and antagonists

    • Investigation of receptor dimerization and higher-order complexes

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis of PTGER2-mediated signaling pathways

    • Mathematical modeling of prostaglandin receptor dynamics in complex tissues

  • Advanced genetic tools:

    • Tissue-specific and inducible PTGER2 knockout models

    • CRISPR-based screens for PTGER2 modulators

    • Single-cell resolution of PTGER2 function in heterogeneous tissues

  • Therapeutic applications:

    • Development of highly selective PTGER2 modulators for clinical applications

    • Investigation of PTGER2 targeting in cancer immunotherapy

    • Exploration of PTGER2's potential in reproductive medicine

  • Translational research:

    • Biomarker development based on PTGER2 expression or activation

    • Patient stratification strategies for PTGER2-targeted therapies

    • Pharmacogenomic studies of PTGER2 pathway variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.