Recombinant Human Prostaglandin E2 receptor EP3 subtype (PTGER3)

Shipped with Ice Packs
In Stock

Description

Isoforms and Signaling Diversity

PTGER3 exhibits functional diversity due to alternative mRNA splicing, generating eight human isoforms (EP3-1 to EP3-8) . These isoforms differ in their C-terminal cytoplasmic tails, which dictate G-protein coupling and downstream effects:

IsoformSignaling PathwayKey Functional Impact
EP3α/EP3βActivates Gαᵢ and Gα₁₂Inhibits cAMP, increases Ca²⁺ influx
EP3γActivates Gαᵢ, Gα₁₂, and GαₛModulates cAMP and phospholipase C pathways
EP3-IVRapid desensitization of PGE₂ bindingTransient inhibition of cAMP

These isoforms are differentially expressed in tissues such as the kidney, stomach, and heart, contributing to organ-specific PGE₂ effects .

Cardiovascular System

  • Hypertension: PTGER3 activation exacerbates angiotensin II-induced hypertension and cardiac dysfunction. Antagonists like L798,106 reduce blood pressure and improve cardiac output in preclinical models .

  • Oxidative Stress: Overexpression of PTGER3 in cardiomyocytes increases NADPH oxidase 2 (Nox2) expression, promoting reactive oxygen species (ROS) and inflammation .

Oncology

  • Ovarian Cancer: PTGER3 upregulates the Ras-MAPK/Erk-ETS1-ELK1 axis, driving cisplatin resistance and tumor growth. Silencing PTGER3 with siRNA restores drug sensitivity and reduces tumor burden by 98% in mouse models .

  • Prostate and Breast Cancer: PTGER3 modulates sex hormone receptor expression, influencing tumor progression .

Inflammation

  • PTGER3 activation in immune cells amplifies proinflammatory cytokines (e.g., TNF-α, IL-1β) while suppressing anti-inflammatory IL-10 .

Agonists and Antagonists

CompoundActivityApplication
SulprostoneEP3-selective agonistStudy of Gi-mediated cAMP inhibition
L798,106EP3 antagonistHypertension and cardiac dysfunction models
ONO-AE3-240EP3 antagonistAnti-thrombotic therapy development

Experimental Models

  • EP3-Transgenic Mice: Overexpression in cardiomyocytes worsens cardiac function and inflammation .

  • CHO Cell Transfectants: Used to characterize isoform-specific cAMP and Ca²⁺ responses .

Clinical and Research Implications

  • Drug Resistance: PTGER3-mediated Ras-MAPK activation is a barrier to chemotherapy efficacy in ovarian cancer. Combining PTGER3 inhibitors with cisplatin improves outcomes .

  • Inflammatory Diseases: Targeting PTGER3 may mitigate inflammation-driven pathologies like arthritis and atherosclerosis .

Key Research Findings

  1. Cardiac Dysfunction: EP3 receptor antagonism reduces angiotensin II-induced hypertension and preserves cardiac contractility .

  2. Isoform-Specific Signaling: EP3γ uniquely activates both inhibitory (Gαᵢ) and stimulatory (Gαₛ) pathways, highlighting its dual regulatory role .

  3. Tumor Microenvironment: PTGER3 promotes platelet aggregation, enhancing chemoresistance in ovarian cancer .

Future Directions

  • Isoform-Specific Drugs: Developing ligands targeting individual EP3 isoforms could minimize off-target effects.

  • Gene Silencing Therapies: siRNA-based PTGER3 inhibition shows promise in preclinical cancer models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PTGER3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; PGE2-R; Prostanoid EP3 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Uniprot No.

Target Background

Function
The prostaglandin E2 (PGE2) receptor EP3 is a G protein-coupled receptor that mediates PGE2 signaling. Its activation can lead to both inhibition of adenylate cyclase via G(i) proteins and elevation of intracellular calcium. EP3 plays a critical role in fever development in response to pyrogens (including IL1B, PGE2, and bacterial lipopolysaccharide (LPS)), platelet aggregation potentiation by PGE2 (influencing blood coagulation), and enhanced HCO3(-) secretion in the duodenum upon mucosal acidification (protecting the mucosa from acid-induced ulceration). Notably, EP3 is not essential for normal kidney function, urine volume, or osmolality.
Gene References Into Functions
  1. In sporadic breast cancer, EP3 receptor expression, while not strongly linked to clinicopathological parameters, significantly predicts improved progression-free and overall survival. However, the precise functional role of EP3 in breast cancer and its counteraction against the pro-tumorigenic effects of elevated PGE2 and COX-2 overexpression require further investigation. PMID: 29661238
  2. Studies demonstrate elevated EP3 expression in TSC2-deficient patient-derived cells compared to TSC2-addback cells, with EP3 antagonists selectively suppressing proliferation in TSC2-deficient cells. Rheb mediates this elevated EP3 expression independently of mTORC1. PMID: 28710231
  3. EP3 expression correlates with FIGO classification in cervical carcinoma, with higher expression associated with poorer overall survival. Furthermore, EP3 expression varies across histological subtypes, showing a worse prognosis in adenocarcinoma patients with high EP3 expression. PMID: 28753926
  4. EP3 signaling impairs hippocampal presynaptic long-term plasticity in Alzheimer's disease. PMID: 27837675
  5. Prostaglandin E2 EP3 receptor contributes to thrombin-induced brain damage through Rho-Rho kinase-mediated cytotoxicity and proinflammatory responses. PMID: 26661165
  6. Residue S211L within EP3 is crucial for differentiating PGE1 and PGE2 binding, mediating diverse biological functions at the initial recognition step. PMID: 28065721
  7. Research highlights the roles of EP3 and the mechanisms through which PGE2 regulates beta-catenin expression, promoting cholangiocarcinoma cell growth and invasion. PMID: 26058972
  8. Studies indicate that the risk of unsuccessful periodontal treatment is associated with tag SNPs in genes regulating the inflammatory response, including one linked to sPTB. PMID: 23805813
  9. Failure of cervical ripening after local prostaglandin application for labor induction may be due to increased EP3 expression and decreased EP4 expression. PMID: 24180609
  10. Human prostate cancer is associated with EP4 and EP2 overexpression and reduced EP3 expression. PMID: 23364535
  11. EP3 downregulation contributes to prostate carcinogenesis and progression from androgen-dependent to castration-resistant prostate cancer by modulating androgen receptor expression. PMID: 23493387
  12. The neuronal prostaglandin E2 receptor subtype EP3 mediates antinociception during inflammation. PMID: 23904482
  13. Prostaglandin E2 receptor EP3 is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion. PMID: 23349487
  14. Postsynaptically located EP(3) receptors strongly contract human pulmonary arteries. PMID: 23406763
  15. The PGE(2) EP3 receptor is identified as a novel proinflammatory, proamyloidogenic, and synaptotoxic signaling pathway, suggesting a role for COX-PGE(2)-EP3 signaling in Alzheimer's disease development. PMID: 22915243
  16. Laropiprant attenuates platelet activation induced by thromboxane (TP) and E-type prostanoid (EP)-3 receptor stimulation, as shown in platelet aggregation assays. PMID: 22870195
  17. Epistatic interaction with the prostaglandin E receptor 3 gene increases the risk of Stevens-Johnson syndrome with severe ocular surface complications. PMID: 22421267
  18. Prostaglandin E2-induced contraction of human intercostal arteries is mediated by the EP3 receptor. PMID: 22342278
  19. Increased mRNA levels of prostaglandin-endoperoxide synthase 1 (PTGS1; COX-1) and prostaglandin-endoperoxide receptor 3 (PTGER3) are observed in patients with schizophrenia. PMID: 22397921
  20. EP3 is the primary receptor mediating PGE(2)-induced contractility in human term pregnant myometrium, representing a potential therapeutic target. PMID: 22162473
  21. EP3 downregulation is linked to the pathogenesis and pathology of Stevens-Johnson syndrome/toxic epidermal necrolysis and ocular cicatricial pemphigoid, suggesting a shared pathophysiological mechanism. PMID: 21966456
  22. A positive feedback loop involving COX-2/PGE2/EP3 receptor-dependent EGFR reactivation amplifies IL-8 production in NCI-H292 cancer cells but not in normal NHBE cells. PMID: 21925169
  23. The role of PGE(2) in human atherosclerotic plaque on platelet EP(3) and EP(4) receptor activation and platelet function in whole blood. PMID: 21424266
  24. Lower EP3 levels are found in the conjunctival epithelial cells of Stevens-Johnson syndrome patients. PMID: 20947153
  25. EP3 is downregulated in endometriosis tissues. PMID: 20452033
  26. Studies indicate an association between PTGER3 and PON1 genotypes and preterm birth. PMID: 20140262
  27. EP3 regulates vascular remodeling (VM) and the associated increase in MMP-2 enzyme activity. PMID: 20503412
  28. Research reveals novel activities of COX-2/PGE2-EP3/EP4 signaling in modulating tumor biology, suggesting a crucial role for the CXCL12/CXCR4 axis in tumor stromal formation and angiogenesis under prostaglandin control. PMID: 20110411
  29. EP3 receptor signaling on endothelial cells is essential for MMP-9 upregulation, which enhances tumor metastasis and angiogenesis. PMID: 19799610
  30. Significantly lower expression of prostaglandin E receptor 3-2 is observed in gravid compared to nongravid myometrium, while prostaglandin E receptor 3-6 mRNA levels are higher in gravid samples. PMID: 12699873
  31. An EP3 agonist, representing an inhibitory pathway, antagonized activities induced by PGE(2), generally reflecting changes in aromatase protein and mRNA expression. PMID: 12788892
  32. EP3 and EP4 mediate distinct actions of PGE2 on mature human osteoclasts: EP4 inhibits actin ring formation, while EP3 increases lamellipodia numbers. PMID: 15290741
  33. When expressed in HEK293 cells, EP3 isoforms localize to the cell surface, although a fraction of some isoforms remain intracellular. PMID: 15304361
  34. Prostaglandin (PG)E2 elevates intracellular calcium levels in the Jurkat T-leukemic cell line through the E-prostanoid (EP)3 receptor. PMID: 15528329
  35. EP3 receptors induce epidermal growth inhibition via diacylglycerol and ceramide second messengers. PMID: 16274459
  36. NMR analysis of an intracellular loop peptide from the prostaglandin EP3alpha receptor. PMID: 16707103
  37. Association between essential hypertension and nucleotide polymorphisms in the gene encoding the prostaglandin E2 receptor subtype EP2 (PTGER2). PMID: 17644362
  38. Genetic variations (single nucleotide polymorphism 1388T>C) in the Ptger3 gene are significantly associated with asthma risk and severity in the Korean population. PMID: 17877755
  39. A new mRNA splice variant of the EP3 gene, EP3-Ic, is identified in human gastric fundic mucosa, mammary artery, and pulmonary vessels, predicted to translate into the EP3-I isoform. PMID: 18023986
  40. EP3 is expressed in trigeminal neurons (53% of total neurons) and co-expressed in TRPV(1)-positive neurons (67% of TRPV(1)-positive neurons). PMID: 18296611
  41. Expression of prostanoid receptors (prostaglandin E2 EP3-I, prostacyclin, and thromboxane A2 receptors) in vascular inflammation influences cell responses depending on constitutive ghrelin receptor activation. PMID: 18573679
  42. EP3 receptors are involved in bladder micturition at supraspinal and spinal centers and in bladder nociception at the spinal cord. PMID: 18632791
  43. Non-conserved residues S211 and R214 of the human EP3 are involved in PGE(2) recognition. PMID: 18652829
  44. Prostaglandin E(2) stimulation of the EP3(I) isoform increases mRNA expression of both VEGF and its receptor VEGF receptor-1. PMID: 18996083
  45. The contributions of EP3 to platelet function are examined using the selective EP3 agonist sulprostone and PGE(2). PMID: 19012178
  46. Decreased mRNA expression of lower-uterine segment EP3 receptor isoforms II and VI is observed during human labor. PMID: 19165680
Database Links

HGNC: 9595

OMIM: 176806

KEGG: hsa:5733

STRING: 9606.ENSP00000349003

UniGene: Hs.445000

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in kidney. Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.

Q&A

What is the structure and function of PTGER3 in human physiology?

PTGER3 is a G-protein coupled receptor containing seven transmembrane domains with multiple splice variants that differ primarily in their C-terminal regions. Functionally, it mediates the effects of prostaglandin E2 (PGE2) in various physiological processes. Unlike other EP receptors that typically increase cAMP, PTGER3 often signals through inhibitory G proteins (Gi) to decrease cAMP levels, though some isoforms can couple to other G proteins. It plays a crucial role in various pathological processes, including the regulation of vascular tone, inflammation, and urine concentration and dilution .

How do PTGER3 genetic polymorphisms affect physiological responses?

PTGER3 genetic variants significantly impact physiological responses and disease susceptibility. The SNP rs17482751 is associated with diastolic blood pressure response to high salt intervention, suggesting its role in salt sensitivity . Several SNPs (rs11209733, rs3765894, and rs2268062) are significantly associated with longitudinal changes of systolic blood pressure, diastolic blood pressure, and mean arterial pressure over 14 years . Additionally, the PTGER3 haplotype ATAAA (composed of rs2206344, rs3765894, SNP_A-4228934, rs2744918, and rs2268062) has been associated with increased risk of hypertension in white Europeans . Longitudinal studies have also found a significant correlation between SNP rs17482751 and the incidence of hypertension after a 14-year follow-up period .

What signaling pathways are modulated by PTGER3 activation?

PTGER3 activation initiates several distinct signaling cascades:

  • Inhibition of adenylyl cyclase: Primary signaling occurs through Gi protein coupling, leading to reduced intracellular cAMP.

  • Ras-MAPK/Erk pathway: PTGER3 promotes resistance to chemotherapy drugs through regulation of the Ras-MAPK/Erk-ETS1-ELK1 pathway in ovarian cancer cells, resulting in increased cell growth and reduced apoptosis .

  • Sympathetic nervous system activation: Under high-salt diet conditions, PTGER3 mediates heightened sympathetic nerve activation, stimulating immune cells involved in the development of salt-sensitive hypertension .

  • Inflammatory response regulation: PTGER3 influences blood pressure through interaction with proinflammatory cytokines such as TNF-α and IL-1β .

Understanding these pathways provides critical insights for targeting PTGER3 in various disease contexts.

How is PTGER3 expression regulated across different tissues?

PTGER3 expression varies significantly across tissues, reflecting its diverse physiological roles:

  • Vascular system: PTGER3 is expressed in both systemic and renal vascular systems, where its activation has been linked to salt-induced vasodilation damage and salt-sensitive hypertension .

  • Central nervous system: PTGER3 is present in brain regions involved in sympathetic nerve regulation, where it mediates prostaglandin E2 effects on blood pressure control .

  • Kidney: PTGER3 expression in multiple segments of the renal tubule contributes to its role in regulating water reabsorption and urine concentration .

  • Cancer tissues: Elevated PTGER3 expression has been observed in several cancer types, including ovarian cancer, where it contributes to chemoresistance and tumor progression .

Expression regulation involves complex transcriptional, post-transcriptional, and epigenetic mechanisms that vary by tissue type and physiological state.

What methodologies are most effective for studying PTGER3's role in blood pressure regulation?

Several complementary methodologies provide robust insights into PTGER3's cardiovascular effects:

  • Genetic approaches:

    • PTGER3 knockout mice compared to wild-type counterparts

    • Human genetic association studies correlating PTGER3 variants with hypertension

    • Targeted gene silencing using siRNA

  • Pharmacological methods:

    • PTGER3-specific agonists and antagonists administration

    • Dose-response studies to characterize vascular reactivity

    • Combination studies with other vasoactive compounds

  • Physiological measurements:

    • Rigorous blood pressure monitoring (9 measurements recommended to reduce bias)

    • 24-hour urinary sodium excretion to confirm compliance with salt interventions

    • Telemetric monitoring in animal models

  • Salt sensitivity protocols:

    • The Genetic Epidemiology Network of Salt Sensitivity (GenSalt) dietary intervention protocol

    • Controlled chronic salt loading interventions

    • Measurement of blood pressure responses to salt challenges

These approaches have revealed that PTGER3 mediates sympathetic responses by binding to central PGE2, influences blood pressure through inflammatory cytokine interactions, and plays a role in angiotensin II-dependent hypertension .

How does PTGER3 contribute to salt-sensitive hypertension mechanisms?

PTGER3 plays multiple mechanistic roles in salt-sensitive hypertension:

  • Enhanced sympathetic activation: Under high-salt diet conditions, wild-type mice with functional PTGER3 exhibit heightened sympathetic nerve activation compared to PTGER3 knockout mice, stimulating immune cells involved in the development of salt-sensitive hypertension .

  • Inflammatory mediation: Under continuous hypertensive stimulation, wild-type mice experienced significant systolic blood pressure increases, accompanied by renal T cell infiltration and accumulation of isolevuglandin adduct in spleen dendritic cells - phenomena completely suppressed in PTGER3 knockout mice .

  • Vascular effects: PTGER3 activation in both systemic and renal vascular systems is linked to salt-induced vasodilation damage and salt-sensitive hypertension .

  • Angiotensin II interaction: Synchronized signaling between angiotensin II receptor 1 and PTGER3 in peripheral arteries promotes vasoconstriction, contributing to hypertension development .

  • Genetic associations: Human studies have demonstrated a significant association between PTGER3 SNP rs17482751 and the response of diastolic blood pressure to high salt intervention .

These mechanisms highlight PTGER3 as a potential therapeutic target for salt-sensitive hypertension.

What experimental design considerations are essential for PTGER3 cardiovascular studies?

Robust PTGER3 cardiovascular research requires several methodological considerations:

  • Population selection:

    • Genetic homogeneity among participants (family-based approaches in rural areas can help)

    • Similar living and dietary habits to reduce environmental confounders

    • Proper exclusion criteria for liver/kidney dysfunction and cardiovascular disease

  • Intervention protocols:

    • Standardized salt intervention protocols (e.g., GenSalt study protocol)

    • Rigorous chronic salt loading intervention for objective assessment

    • Confirmation of compliance through 24-h excretion of urine sodium

  • Measurement standards:

    • Multiple blood pressure measurements (nine times recommended) including baseline and during intervention stages

    • Consistent timing and methodology for measurements

    • Long-term follow-up (14+ years) for longitudinal studies

  • Genetic analysis:

    • Comprehensive genotyping of PTGER3 SNPs

    • Haplotype analysis rather than focusing on single polymorphisms

    • Validation in populations with different genetic backgrounds

  • Controls and validation:

    • Appropriate controls for pharmacological interventions

    • Consideration of sex-specific effects

    • Validation cohorts to confirm findings

These considerations minimize bias and strengthen the validity of PTGER3 cardiovascular research findings.

How does PTGER3 contribute to chemoresistance mechanisms in cancer?

PTGER3 promotes chemoresistance through several interconnected mechanisms:

  • Activation of pro-survival signaling: PTGER3 promotes drug resistance through regulation of the Ras-MAPK/Erk-ETS1-ELK1 pathway in ovarian cancer cells, resulting in increased cell growth and reduced apoptosis .

  • Enhanced cancer cell survival: Activation of PTGER3 with specific agonists like Sulprostrone increases cancer cell growth in a dose-dependent manner and elevates expression of survival-promoting proteins. Western blot analysis showed that cells stimulated with Sulprostrone expressed higher levels of PTGER3 and p-MEK1/2 proteins .

  • Reduced drug accumulation: PTGER3 knockdown has been demonstrated to increase platinum drug accumulation in tumor xenografts, suggesting that PTGER3 may modulate drug uptake or efflux mechanisms .

  • Apoptosis resistance: PTGER3 signaling reduces apoptotic responses in cancer cells, contributing to therapy resistance and cellular persistence despite chemotherapeutic treatment .

Understanding these mechanisms provides opportunities for therapeutic interventions to overcome PTGER3-mediated chemoresistance.

What techniques provide optimal PTGER3 silencing in cancer models?

Several advanced techniques have demonstrated effectiveness for PTGER3 silencing in cancer research:

  • Modified siRNA approaches:

    • 2'-OMe-PS2 and 2'-F-PS2 modified siRNAs significantly decreased PTGER3 levels in A2780-CP20 cells compared with unmodified siRNA

    • Effective siRNA concentration: 175 nmol/L demonstrated successful knockdown in vitro

  • Advanced delivery systems:

    • Multistage vector (MSV) system loaded with DOPC (1,2-dioleoyl-sn-glycero-3-phosphatidylcholine) nanoliposomes containing PTGER3 siRNA achieved sustained silencing in xenograft models

    • In vivo dosing: 450-μg/kg of PTGER3 siRNA intravenously biweekly showed efficacy

  • Combination approaches:

    • MSV-DOPC-PTGER3-siRNA + cisplatin resulted in 98% reduction in tumor growth compared with control siRNA with cisplatin

    • This combination approach demonstrated dramatic improvement over either PTGER3 silencing or cisplatin alone

These techniques provide researchers with effective tools for investigating PTGER3's role in cancer biology and developing potential therapeutic approaches.

How does PTGER3 modulate cancer cell migration and invasion capabilities?

PTGER3 significantly influences cancer cell migration and invasion through multiple mechanisms:

  • Enhanced migratory capacity: In wound healing assays, PTGER3 knockdown cells (A2780-CP20 and OVCAR5) showed significantly less migration than control cells after 30 hours .

  • Invasion potential modulation: In Matrigel-coated transwell chamber assays, the percentage of invading A2780-CP20 cells was reduced to 22% and OVCAR5 cells to 32% following PTGER3 knockdown .

  • Colony formation inhibition: PTGER3 knockdown resulted in 4.2 times fewer A2780-CP20 and OVCAR5 colonies compared to control conditions, indicating its importance in clonogenic potential .

  • Angiogenesis regulation: Human endothelial EC-RF24 cells transfected with PTGER3 siRNA formed significantly fewer nodes than control cells in tube formation assays, suggesting PTGER3's role in promoting tumor vascularization .

These findings highlight PTGER3 as a potential therapeutic target for limiting cancer progression and metastasis, with multiple functional assays available to quantify these effects in experimental settings.

What are the most appropriate experimental controls for PTGER3 cancer studies?

Robust PTGER3 cancer research requires comprehensive controls:

  • Genetic manipulation controls:

    • Negative control siRNA for PTGER3 knockdown studies

    • Empty vector controls for overexpression studies

    • Rescue experiments with wild-type PTGER3 to confirm specificity

  • Pharmacological intervention controls:

    • Vehicle controls for all compounds

    • Dose-response curves for PTGER3 agonists like Sulprostrone

    • Time-course studies to capture temporal dynamics

  • Cell line considerations:

    • Testing in multiple cell lines (e.g., both A2780-CP20 and OVCAR5)

    • Comparison with normal (non-cancer) cells

    • Validation across cell lines with different baseline PTGER3 expression

  • Functional assay controls:

    • Standardized conditions for migration (30h timepoint), invasion (72h timepoint), and colony formation assays

    • Quantitative assessment methods (e.g., counting number of nodes in tube formation assays)

    • Appropriate positive and negative controls for each assay

  • In vivo experimental controls:

    • Multiple control groups: (a) MSV-DOPC-negative control siRNA, (b) MSV-DOPC-PTGER3-siRNA, (c) MSV-DOPC-negative control siRNA + cisplatin

    • Consistent dosing schedules (e.g., siRNA treatments at 450-μg/kg intravenously biweekly, and cisplatin at 160 μg intraperitoneally weekly)

    • Measurement of both tumor growth and nodule counts

These controls ensure that observed effects are specifically attributable to PTGER3 modulation rather than experimental artifacts.

What techniques enable differentiation between PTGER3 and other EP receptor subtypes?

Distinguishing PTGER3-specific effects from other EP receptor subtypes requires multifaceted approaches:

  • Pharmacological differentiation:

    • Sulprostrone as a PTGER3-specific agonist in experimental settings

    • Selective antagonists when available

    • Comparative dose-response studies with various EP receptor modulators

  • Genetic approaches:

    • Selective knockdown using validated siRNAs targeting PTGER3

    • CRISPR-Cas9 mediated knockout of PTGER3 specifically

    • Rescue experiments with PTGER3-specific expression constructs

  • Signaling pathway discrimination:

    • Focus on Gi-mediated pathways (cAMP inhibition) characteristic of PTGER3

    • Assessment of PTGER3-specific downstream effects (e.g., p-MEK1/2 expression)

    • Comparative analysis with EP2/EP4 (Gs-coupled) and EP1 (Gq-coupled) signaling

  • Expression profiling:

    • Quantification of all EP receptor subtypes at mRNA and protein levels

    • Selection of experimental models with favorable PTGER3:other EP receptor ratios

These approaches ensure that observed effects are specifically attributable to PTGER3 rather than other prostaglandin E2 receptor subtypes.

How can researchers address PTGER3 isoform variability in experimental design?

PTGER3 isoform variability presents challenges requiring specific experimental approaches:

  • Isoform identification:

    • RT-PCR with isoform-specific primers targeting variable C-terminal regions

    • RNA-Seq to quantitatively assess isoform expression profiles

    • Western blotting with C-terminal-specific antibodies when available

  • Explicit reporting practices:

    • Clearly state which isoform(s) are being studied in research reports

    • Provide sequence information or reference accession numbers

    • Report relative abundance of different isoforms in the experimental system

  • Isoform-specific genetic manipulation:

    • Design siRNAs targeting either common regions (all isoforms) or specific variable regions

    • CRISPR-Cas9 to selectively modify specific exons

    • Rescue experiments with specific isoforms after global PTGER3 knockdown

  • Signaling pathway analysis:

    • Assess coupling to different G proteins (Gi, Gs, Gq) as isoforms vary in coupling preferences

    • Measure multiple downstream effectors (cAMP, calcium, ERK) to capture diverse signaling

By systematically addressing isoform variability, researchers can develop a more nuanced understanding of PTGER3 biology and avoid oversimplified interpretations.

What quantitative methods accurately measure PTGER3 activity?

PTGER3 activity can be quantified through multiple complementary approaches:

  • Ligand binding assays:

    • Saturation binding with [³H]-PGE2 or fluorescent analogs

    • Competition binding studies with labeled ligands and unlabeled competitors

    • Determination of Kd, Ki, and Bmax values for quantitative assessment

  • G protein coupling measurements:

    • [³⁵S]GTPγS binding assay to measure G protein activation

    • BRET or FRET-based assays for real-time monitoring of receptor-G protein interactions

    • IP₁ accumulation assays (for Gq-coupled isoforms)

  • Downstream signaling assessment:

    • cAMP inhibition assays (for Gi-coupled isoforms)

    • ERK1/2 phosphorylation quantification via Western blotting

    • Calcium flux measurements using fluorescent calcium indicators

  • Functional cellular assays:

    • Migration assays to measure PTGER3-dependent cell motility

    • Invasion assays in Matrigel-coated transwell chambers

    • Colony formation assays to assess cellular proliferation

  • In vivo activity measurements:

    • Blood pressure responses to PTGER3 modulation

    • Tumor growth in xenograft models with PTGER3 silencing

    • Assessment of inflammatory markers in relevant tissues

These diverse methodologies provide complementary information about PTGER3 activity across multiple experimental contexts.

How can CRISPR-Cas9 be optimally applied for PTGER3 functional studies?

CRISPR-Cas9 technology offers powerful approaches for investigating PTGER3 function:

  • Gene knockout applications:

    • Complete PTGER3 ablation to study loss-of-function phenotypes

    • Generation of isogenic cell line pairs (wild-type vs. PTGER3-knockout)

    • Creation of PTGER3 knockout animal models as alternatives to traditional transgenic approaches

  • SNP modeling:

    • Introduction of specific PTGER3 polymorphisms identified in human studies (e.g., rs17482751, rs11209733, rs3765894, rs2268062)

    • Creation of isogenic cell lines differing only in SNP status

    • Functional characterization of SNP effects on receptor expression, signaling, and physiological responses

  • Isoform-specific modifications:

    • Targeted deletion of specific exons to eliminate particular PTGER3 splice variants

    • Introduction of premature stop codons to truncate specific isoforms

    • Assessment of isoform-specific contributions to different signaling pathways

  • Domain mapping:

    • Introduction of small deletions or mutations in specific receptor domains

    • Structure-function analysis of ligand binding, G-protein coupling, and regulatory domains

    • Identification of critical residues for specific signaling pathways

These CRISPR-based approaches provide unprecedented precision in manipulating PTGER3 genetics, enabling detailed mechanistic studies that were previously challenging with traditional methods.

How do findings from animal models of PTGER3 function translate to human physiology?

Translational aspects of PTGER3 research require careful consideration of species differences and model selection:

  • Cardiovascular translation:

    • PTGER3 knockout mice have been valuable for understanding receptor function in blood pressure regulation

    • Human genetic studies have confirmed associations of PTGER3 variants with hypertension susceptibility and salt sensitivity

    • Experimental findings in spontaneously hypertensive rats (blocking PTGER3 inhibits hypertension development) provide potential therapeutic insights

  • Cancer research translation:

    • Orthotopic xenograft models using human cancer cell lines (A2780-CP20 and OVCAR5) provide insights into PTGER3's role in human cancer biology

    • MSV-DOPC-PTGER3-siRNA delivery systems have shown efficacy in these models, suggesting potential for human application

    • Combined approaches (PTGER3 silencing plus chemotherapy) demonstrated dramatic tumor reduction (98%), indicating potential clinical strategies

  • Methodological considerations for translation:

    • Family-based approaches in human populations with genetic homogeneity reduce population stratification bias

    • Long-term follow-up studies (14+ years) provide valuable insights into chronic disease development

    • Multiple blood pressure measurements and rigorous intervention protocols enhance reliability

  • Limitations requiring attention:

    • Species differences in PTGER3 expression, distribution, and function

    • Potential compensatory mechanisms in chronic PTGER3 modulation

    • Need for validation across multiple models and human studies

Successful translation requires integrating findings from multiple model systems while acknowledging their limitations.

What statistical approaches are most appropriate for analyzing PTGER3 genetic association data?

Analysis of PTGER3 genetic data requires robust statistical approaches:

  • Single marker analyses:

    • Assessment of individual SNPs (rs17482751, rs11209733, rs3765894, rs2268062) and their associations with phenotypes

    • Adjustment for multiple testing to control false discovery rate

    • Consideration of dominant, recessive, and additive genetic models

  • Haplotype analyses:

    • Analysis of SNP combinations (e.g., ATAAA haplotype consisting of rs2206344, rs3765894, SNP_A-4228934, rs2744918, rs2268062)

    • Phase determination and frequency estimation

    • Assessment of haplotype associations with disease phenotypes

  • Longitudinal data analysis:

    • Mixed-effects models for repeated measures over time (e.g., 14-year blood pressure trajectories)

    • Survival analysis for time-to-event outcomes (e.g., hypertension incidence)

    • Adjustment for baseline characteristics and potential confounders

  • Population structure considerations:

    • Family-based association approaches to minimize population stratification

    • Principal component analysis to identify and adjust for genetic ancestry

    • Genomic control methods when appropriate

  • Gene-environment interaction analyses:

    • Assessment of PTGER3 variant interactions with environmental factors (e.g., dietary sodium)

    • Stratified analyses across exposure levels

    • Formal statistical testing of interaction terms

These statistical approaches help establish valid associations between PTGER3 genetic variants and physiological or pathological outcomes while minimizing false positives.

How might PTGER3 research inform precision medicine approaches?

PTGER3 research offers several avenues for precision medicine applications:

  • Pharmacogenomic applications:

    • PTGER3 genetic variants may predict response to antihypertensive therapies

    • SNPs associated with salt sensitivity (e.g., rs17482751) could guide personalized dietary recommendations

    • PTGER3 expression patterns in tumors might predict chemotherapy resistance

  • Risk stratification:

    • Genetic testing for PTGER3 variants associated with hypertension risk (e.g., ATAAA haplotype)

    • Identification of individuals at elevated risk for salt-sensitive hypertension

    • Longitudinal monitoring of high-risk individuals based on genetic profiles

  • Targeted therapeutic approaches:

    • PTGER3 silencing strategies for chemoresistant cancers

    • Combined approaches (e.g., PTGER3 inhibition plus conventional chemotherapy)

    • PTGER3 antagonists for treatment-resistant hypertension, particularly salt-sensitive forms

  • Biomarker development:

    • PTGER3 expression levels as indicators of disease progression

    • Signaling pathway activation (e.g., p-MEK1/2 levels) as pharmacodynamic markers

    • Genetic variants as predictive biomarkers for treatment response

  • Implementation considerations:

    • Need for validation across diverse populations

    • Cost-effectiveness analysis of genetic testing approaches

    • Integration with electronic health records and clinical decision support systems

These precision medicine applications represent the translational potential of basic and clinical PTGER3 research findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.