Recombinant Human Prostasin (PRSS8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Prostasin (PRSS8)

Prostasin, encoded by the PRSS8 gene in humans, is a trypsin-like serine protease that plays roles in epithelial physiology . It is also known as channel activating protease 1 (CAP1) .

Basic Information and Characteristics

CharacteristicDescription
SynonymsCAP1, PROSTASIN
SpeciesHuman
Expression HostHEK293 Cells
SequenceAla 30-Arg 322
AccessionNP_002764.1
Calculated Molecular Weight32.8 kDa
Observed Molecular Weight40 kDa
TagC-His
Purity> 97 % as determined by reducing SDS-PAGE
Endotoxin< 1.0 EU per μg of the protein as determined by the LAL method
Bio-activityMeasured by its ability to cleave the fluorogenic peptide substrate Boc-QAR-AMC (R&D Systems, Catalog # ES014). The specific activity is > 10 pmoles/min/μg .

Expression and Localization

Prostasin is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid . It is also highly expressed in the prostate, lung, kidney, salivary gland, and pancreas . At the cellular level, prostasin overexpression is largely localized to tumor epithelium and is absent in neighboring stroma in ovarian cancer tissues .

Function and Role

  1. Epithelial Sodium Channel (ENaC) Regulation: Prostasin activates the ENaC, which is critical for maintaining salt and fluid balance in the lung and kidney in both normal and pathological conditions . It helps regulate tissue functions involving a sodium channel .

  2. Tumor Suppression: Prostasin inhibits prostate and breast cancer cell invasion in vitro, suggesting a role as a suppressor of tumor invasion .

  3. Insulin Sensitivity: Prostasin protects the liver from chronic inflammation by cleaving and shedding TLR4, preventing the development of insulin resistance. Downregulation of PRSS8 via ER stress contributes to hepatic insulin resistance and diabetes .

  4. Insulin Secretion: PRSS8 is involved in glucose-dependent physiological regulation of insulin secretion via the EGF–EGFR signaling pathway in pancreatic β-cells .

  5. Epidermal Development: Prostasin has an essential role in terminal epidermal differentiation and postnatal survival .

Clinical Significance

  1. Ovarian Cancer Biomarker: Overexpression of PRSS8 mRNA and high levels of prostasin in early-stage ovarian tumors suggest it as a potential clinical biomarker .

  2. Hypertension: The human prostasin gene might be a candidate gene underlying blood pressure elevation .

  3. Diabetes and Cancer Risk: High prostasin plasma levels may be associated with a higher risk for diabetes and death from cancer, especially in people with high blood sugar .

  4. Insulin Resistance and Diabetes: PRSS8 protects the liver from chronic inflammation via the proteolytic cleavage and shedding of TLR4, consequently preventing the liver from developing insulin resistance .

Research Findings

  1. TLR4 Cleavage: PRSS8 reduces the level of TLR4 on the plasma membrane via proteolytic cleavage and shedding of the TLR4 extracellular domain. Mutational analysis showed that the K560A/K561A mutant was completely protected against cleavage by PRSS8 .

  2. Insulin Secretion Mechanism: Glucose intolerance and reduction in glucose-stimulated insulin secretion developed in βKO mice compared with control subjects. PRSS8 overexpression significantly increased insulin secretion from the early phase compared with controls .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Dry ice shipping incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
PRSS8; Prostasin; Channel-activating protease 1; CAP1; Serine protease 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-322
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
PRSS8
Target Protein Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQ LDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPN GLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCA GYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSK VTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLR
Uniprot No.

Target Background

Function
Recombinant Human Prostasin (PRSS8) exhibits trypsin-like cleavage specificity, favoring poly-basic substrates. It stimulates epithelial sodium channel (ENaC) activity by activating the cleavage of its gamma subunits (SCNN1G).
Gene References Into Functions

References and Functional Implications of PRSS8 (Prostasin):

  1. HAI-2's limited role in inhibiting matriptase and prostasin results from its primarily intracellular localization in basal and spinous layer keratinocytes, preventing interaction with active prostasin or matriptase. PMID: 29438412
  2. PRSS8 downregulation in glioma tissues suggests a role in glioma cell proliferation, migration, and invasion. PMID: 27983922
  3. PRSS8 functions as a tumor suppressor in colorectal cancer. PMID: 27050145
  4. Reduced PRSS8 in esophageal squamous cell carcinomas (ESCC) correlates with poor differentiation and shorter survival. PMID: 27081034
  5. In T84 colonic cell monolayers, colitis-associated Th2 cytokines (IL-4 and IL-13) disrupt the barrier by downregulating matriptase and prostasin via STAT6 phosphorylation. PMID: 28490634
  6. PRSS8 may act as a tumor suppressor in hepatocellular carcinoma progression. PMID: 27915333
  7. Elevated PRSS8 mRNA and prostasin in early-stage ovarian tumors may serve as biomarkers for early detection. PMID: 27036110
  8. Prostasin protein level changes are unlikely to be causally involved in placental dysfunction in preeclampsia. PMID: 26867056
  9. Urinary exosomes show a diurnal pattern of NCC and prostasin parallel to ADH and aquaporin 2, indicating a link to water balance. PMID: 25931204
  10. Prostasin gene polymorphism is associated with poor pregnancy outcomes in early-onset severe preeclampsia. PMID: 26252104
  11. Prostasin regulates the Lin28/Let-7 loop in ovarian cancer cells. PMID: 25188517
  12. The C allele of prostasin gene at rs12597511 is associated with severe preeclampsia. PMID: 24890150
  13. Prostasin represses cancer cells and contributes to chemoresistance by modulating the CASP/PAK2-p34/actin pathway. PMID: 24434518
  14. Axl and prostasin expression may be related to carcinogenesis, metastasis, and prognosis of ovarian adenocarcinoma. PMID: 23707658
  15. Urinary prostasin correlates with the aldosterone to renin ratio and is modulated by natriuresis in normotensive individuals. PMID: 23344129
  16. Prostasin acts as a non-enzymatic co-factor for matriptase activation. PMID: 23673661
  17. Prostasin requires endogenous matriptase to stimulate barrier formation. PMID: 23443662
  18. Essential hypertension in Xinjiang Kazakhs is not associated with the 2827C>T polymorphism in the prostasin gene. PMID: 20078940
  19. Prostasin is present, mature, and active on the apical surface of wild-type and cystic fibrosis bronchial epithelial cells. PMID: 22582115
  20. There is no major role of prostasin variation in blood pressure modulation. PMID: 21933610
  21. Matriptase and prostasin expression is closely correlated in breast cancer cell lines and tissues, with a similar spatial expression pattern. PMID: 21678412
  22. Prostasin is transported via the transcytotic pathway, making it a substrate for matriptase. PMID: 21148558
  23. The matriptase-prostasin proteolytic cascade is regulated by prostasin activation coupled to matriptase autoactivation and HAI-1 inhibition of both active matriptase and prostasin. PMID: 20696767
  24. Prostasin is overexpressed in many epithelial ovarian cancers, a potential tumor marker. PMID: 19606239
  25. Hepsin activates prostasin and cleaves the extracellular domain of the epidermal growth factor receptor. PMID: 19911255
  26. Prostasin increases the transcriptional activity of CYP11B2. PMID: 20204133
  27. Prostasin may regulate trophoblast cell proliferation via the EGFR-MAPK signaling pathway. PMID: 20089521
  28. In JEG-3 cells, anti-prostasin antibodies promote cell invasion and increase MMP-2, MMP-26, TIMP-1, and TIMP-4 production. PMID: 19847458
  29. Loss of prostasin expression in bladder transitional cell carcinomas is associated with epithelial-mesenchymal transition. PMID: 19849847
  30. Protease-mediated regulation of sodium absorption is a function of human airway epithelia, with prostasin as a likely candidate. PMID: 11756432
  31. Prostasin is a major regulator of ENaC-mediated Na+ current in DeltaF508 cystic fibrosis epithelia. PMID: 15246975
  32. Prostasin is a channel-activating protease; its substrate specificity has been analyzed. PMID: 15474520
  33. HAI-1B is a potential physiological regulator of prostasin function. PMID: 16103126
  34. Dihydrotestosterone regulates prostasin expression in prostate cells via SREBP stimulation and SLUG repression of the prostasin promoter. PMID: 16541421
  35. The PRSS8 gene effectively separates chromophobe renal cell carcinoma (RCC) and benign oncocytoma groups by qRT-PCR. PMID: 17145811
  36. Prostasin induces protease-dependent and independent molecular changes in PC-3 prostate carcinoma cells. PMID: 17532063
  37. Reduced matriptase-prostasin proteolytic cascade activity is implicated in human ARIH. PMID: 17940283
  38. Prostasin and PN-1 regulate Na+ absorption in the airway, and abnormal prostasin expression contributes to ENaC activation in cystic fibrosis. PMID: 18310226
  39. Prostasin gene variation may be involved in youth hypertension. PMID: 18583984
  40. Crystallographic analysis of prostasin has been performed. PMID: 18922802
  41. Urinary prostasin may be a biomarker for renal pressure natriuresis in normotensive black adolescents. PMID: 19127211
  42. The relationship between aldosterone and prostasin expression is unclear. PMID: 19262497
  43. Structures of the active prostasin extracellular domain show S1 subsite loop opening and closing in response to basic residues or divalent ions, directly binding Ca(+2). PMID: 19388054
  44. PN-1 mRNA is significantly elevated in colorectal cancer tissue. PMID: 19555470
Database Links

HGNC: 9491

OMIM: 600823

KEGG: hsa:5652

STRING: 9606.ENSP00000319730

UniGene: Hs.75799

Protein Families
Peptidase S1 family
Subcellular Location
[Prostasin]: Cell membrane; Single-pass membrane protein.; [Prostasin light chain]: Secreted, extracellular space. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus.; [Prostasin heavy chain]: Secreted, extracellular space. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus.
Tissue Specificity
Found in prostate, liver, salivary gland, kidney, lung, pancreas, colon, bronchus and renal proximal tubular cells. In the prostate gland it may be synthesized in epithelial cells, secreted into the ducts, and excreted into the seminal fluid.

Q&A

What is the basic structure of human prostasin and how is it processed in vivo?

Human prostasin (PRSS8) is a trypsin-like serine protease that is initially synthesized as a zymogen (preproenzyme). The mature protein consists of residues Ala33-Gly319, with processing that yields a structure where:

  • The preproenzyme contains an N-terminal signal sequence, propeptide, and a C-terminal glycosylphosphatidylinositol (GPI) anchor domain

  • The proprotein undergoes proteolytic cleavage to produce a light chain and a heavy chain connected by a disulfide bond

  • The active form results when the propeptide is cleaved, most commonly by enterokinase in experimental settings

In recombinant expression systems, researchers typically replace the native signal sequence and propeptide with insect cell signal sequences (like melittin, GP64, or GP67) to generate the native N-terminus of the mature protein .

Which regions of the human body express prostasin, and at what relative levels?

Prostasin demonstrates a tissue-specific expression pattern:

  • Highest expression occurs in the prostate epithelium

  • Moderate to lower expression is found in the lung, kidney, liver, salivary gland, and pancreas

  • The protein is detected in bodily fluids including seminal fluid, urine, and serum

Western blot analysis of human prostate tissue shows prostasin appearing as a specific band at approximately 40 kDa under non-reducing conditions . Immunohistochemistry confirms specific cytoplasmic localization in prostate tissue sections .

What are the functional differences between membrane-bound and soluble forms of prostasin?

Prostasin exists in two main forms with distinct properties:

FeatureMembrane-bound ProstasinSoluble Prostasin
AttachmentGPI-anchored to cell membraneReleased into extracellular fluids
GenerationNative formProteolytic processing of C-terminal domain
DetectionCell-associated (membrane fractions)Found in seminal fluid, urine, serum
FunctionDirect regulation of nearby proteins (e.g., ENaC)Potential paracrine signaling, biomarker
Research utilityCell-based assays, membrane protein interactionsEnzymatic assays, biomarker studies

The C-terminal membrane-spanning domain can be proteolytically processed to generate the secreted form, which has been purified from seminal fluid . For recombinant production, researchers often replace the GPI anchor domain with a His-tag to facilitate purification and create a soluble form .

What are the optimal expression systems for producing active recombinant human prostasin?

Multiple expression systems have been utilized for prostasin production, each with specific advantages and limitations:

Expression SystemAdvantagesConsiderationsNotes
Baculovirus/Insect CellsProper folding and disulfide formationModerate yield (1-5 mg/L)Preferred for crystallography-grade protein
Bacterial (E. coli)High yield, economicalRequires refolding in vitroBL21(DE3) cells with in vitro refolding protocol
Mammalian CellsNative post-translational modificationsLower yield, higher costUsed for specific functional studies

For crystallography and structural studies, baculovirus expression followed by appropriate purification has proven successful . For bacterial expression, researchers have developed effective refolding protocols with glutathione redox systems . Key strategies include:

  • Replacing the native signal sequence with an insect cell signal sequence for proper processing

  • Mutation of non-essential cysteines (C154S and C203A) to improve stability

  • Removal of N-linked glycosylation sites for crystallization studies

How should recombinant prostasin be activated, and what assays can verify its enzymatic activity?

Activation protocol for recombinant prostasin zymogen:

  • Convert zymogen to active form using enterokinase (2 units/ml or 7.5 units/mg prostasin)

  • Include 0.5 mM reduced glutathione during cleavage reaction

  • Maintain reaction at 4°C for 48 hours

  • Add 1 mM oxidized glutathione and incubate overnight at 4°C

  • Purify using Ni(II) affinity and anion exchange chromatography

The standard enzymatic activity assay procedure:

  • Prepare assay buffer: 50 mM Tris, 0.05% (w/v) Brij 35, pH 9.5

  • Dilute recombinant prostasin to 20 μg/mL in assay buffer

  • Dilute substrate (BOC-Gln-Ala-Arg-AMC) to 200 μM in assay buffer

  • Load 50 μL of diluted prostasin into a well of a black microtiter plate

  • Add 50 μL of diluted substrate to start the reaction

  • Include a substrate blank control

  • Read fluorescence at excitation/emission wavelengths of 380/460 nm

  • Calculate specific activity using the formula:
    Specific Activity (pmol/min/μg) = [Adjusted Vmax (RFU/min) × Conversion Factor (pmol/RFU)] ÷ amount of enzyme (μg)

What are the critical considerations when using carrier-free versus BSA-containing prostasin formulations?

The choice between carrier-free and BSA-containing recombinant prostasin depends on experimental objectives:

Formulation TypeRecommended ApplicationsLimitationsStorage Considerations
With BSA carrierCell/tissue culture, ELISA standardsBSA may interfere with some applicationsEnhanced stability, longer shelf-life
Carrier-free (CF)Applications where BSA interference is a concernRequires more careful handlingStore at higher concentration, avoid repeated freeze-thaw

For carrier-free formulations, proper storage is critical:

  • Store immediately upon receipt at recommended temperature

  • Use a manual defrost freezer

  • Avoid repeated freeze-thaw cycles

The carrier-free formulation is typically supplied as a 0.2 μm filtered solution in Tris, NaCl, and CaCl₂ .

How does prostasin regulate epithelial sodium channels (ENaC) and what experimental approaches best demonstrate this interaction?

Prostasin plays a critical role in ENaC regulation through proteolytic processing of channel subunits:

  • Prostasin cleaves the γ-subunit of ENaC, removing an inhibitory peptide and thus activating the channel

  • This activation increases sodium reabsorption in the distal nephron

Experimental approaches to study this interaction include:

  • Oocyte expression systems: Co-expression of prostasin and ENaC in Xenopus oocytes to measure channel activity

  • Cell-based assays: Using mouse cortical collecting duct cell lines to assess ENaC function

  • In vivo models: Comparing ENaC activity in wild-type versus prostasin mutant mice

Interestingly, studies with prostasin mutants have yielded surprising insights:

  • Mice expressing enzymatically inactive endogenous prostasin (Prss8 Cat−/Cat−) display normal tissue development and homeostasis, unlike prostasin null mice (Prss8 −/−)

  • This suggests prostasin may have both catalytic and non-catalytic functions, potentially serving as an allosteric regulator of other membrane-anchored proteases

What role does prostasin play in metabolic disorders and what are the key experimental findings?

Recent research has revealed important connections between prostasin and metabolic disorders:

  • Hepatic insulin sensitivity:

    • Prostasin cleaves toll-like receptor 4 (TLR4) and regulates hepatic insulin sensitivity

    • In liver-specific PRSS8 transgenic (LTg) mice, high-fat-diet feeding resulted in improved glucose tolerance and reduced hepatic steatosis independent of body weight

    • These effects were associated with amplified extracellular signal-regulated kinase phosphorylation and matrix metalloproteinase 14 activation

  • Type 2 diabetes associations:

    • Serum PRSS8 levels are reduced in type 2 diabetes mellitus patients compared to healthy controls

    • Lower levels occur in T2DM patients with increased maximum carotid artery intima media thickness (>1.1 mm)

    • Serum PRSS8 levels correlate with an index of insulin secretory function (HOMA-β) in nondiabetic individuals

  • Molecular mechanisms:

    • In liver-specific prostasin transgenic mice fed a high-fat diet, gene expression analysis revealed:

      • Increased expression of Glut4, Acox1, and Ppara in white adipose tissue

      • Decreased expression of inflammatory markers (Tnfa, Ccl2, Ccr2, and Emr1)

These findings suggest that prostasin could represent a potential therapeutic target for obesity-triggered insulin resistance and dyslipidemia.

How can researchers distinguish between catalytic and non-catalytic functions of prostasin?

Distinguishing between catalytic and non-catalytic functions requires sophisticated experimental approaches:

  • Mutant prostasin models:

    • Catalytically inactive prostasin (Prss8-S238A): Contains a mutation in the catalytic triad

    • Zymogen-locked prostasin (Prss8-R44Q): Cannot undergo proteolytic activation

    • Complete knockout (Prss8−/−): Absence of the protein

  • Key experimental findings:

    • Prss8−/− mice die within 48 hours after birth

    • Prss8 Cat−/Cat− mice (catalytically inactive) develop normally with similar survival rates to wild-type

    • Prss8 Cat−/− mice (heterozygous) show 73% survival through the preweaning period

  • Biochemical verification:
    Western blot analysis shows:

    • Wild-type and S238A prostasin appear as ~39 kDa bands (processed form)

    • R44Q prostasin appears as ~41 kDa band (zymogen form)

    • After deglycosylation, bands appear at ~26 kDa and ~28 kDa respectively

This evidence strongly suggests that some essential functions of prostasin are independent of its catalytic activity, with prostasin potentially acting as an allosteric regulator of other proteases.

What controls should be included when studying prostasin in functional assays?

For robust experimental design, include these essential controls:

  • Enzymatic activity assays:

    • Substrate blank (buffer + substrate without enzyme)

    • Calibration standard using 7-amino, 4-Methyl Coumarin (AMC)

    • Known inhibitors (aprotinin, nafamostat mesylate) as negative controls

    • Heat-inactivated prostasin to distinguish enzymatic from non-enzymatic effects

  • Recombinant protein validation:

    • SDS-PAGE under reducing and non-reducing conditions

    • Mass spectrometry to confirm protein identity and processing

    • Western blot with anti-prostasin antibodies (typically showing bands at ~40 kDa)

  • Cell-based and in vivo studies:

    • Wild-type prostasin

    • Catalytically inactive mutant (S238A)

    • Zymogen-locked mutant (R44Q)

    • Complete knockout

    • Vector-only/vehicle controls for transfection/treatment studies

How should researchers interpret contradictory findings about prostasin's role in different physiological contexts?

Several apparent contradictions exist in prostasin research that require careful interpretation:

  • Blood pressure regulation paradox:

    • Prostasin activates ENaC, which should increase blood pressure

    • Yet liver-specific prostasin knockout mice show insulin resistance but no clear blood pressure phenotype

    Interpretation approach: Consider tissue-specific effects and compensatory mechanisms. Analyze the entire renin-angiotensin-aldosterone system rather than isolated components.

  • Catalytic vs. non-catalytic function contradiction:

    • Catalytic activity is essential for ENaC activation in vitro

    • Catalytically inactive mice develop normally, unlike complete knockout mice

    Interpretation approach: Examine protein-protein interactions and potential scaffolding functions. Consider that catalytic activity may be compensated by other proteases in vivo but not in simpler in vitro systems.

  • Metabolic effects discrepancy:

    • Serum prostasin is lower in T2DM patients (suggesting protective role)

    • But some studies suggest prostasin can impair insulin signaling

    Interpretation approach: Distinguish between correlation and causation. Consider measuring both local tissue levels and circulating levels. Account for potential feedback mechanisms.

What are common troubleshooting issues when working with recombinant prostasin and how can they be addressed?

IssuePossible CausesSolutions
Low enzymatic activityImproper activation, misfolding, inhibitors presentVerify activation with mass spectrometry; optimize redox conditions during folding; purify using activity-based selection
Protein aggregationImproper disulfide formation, hydrophobic interactionsInclude reduced/oxidized glutathione during refolding; maintain at 4°C; consider point mutations C154S and C203A
Inconsistent yieldExpression system variability, purification lossesOptimize codon usage; use insect cell signal sequences for proper processing; purify active fraction using sequential chromatography steps
Batch-to-batch variabilityDifferences in activation efficiency, glycosylationCharacterize each batch by SDS-PAGE, mass spectrometry, and activity assays; consider removing N-glycosylation site if consistent glycosylation is problematic

For recombinant prostasin expressed in bacterial systems, the refolding process is critical:

  • Testing different buffer additives shows varying efficiency:

    • No additives: Poor recovery

    • 2M urea: Improved recovery

    • 0.4M L-arginine: Highest recovery of soluble protein

What methodological approaches allow researchers to study prostasin-protein interactions?

To investigate prostasin interactions with other proteins, researchers can employ the following approaches:

  • Biochemical approaches:

    • Co-immunoprecipitation using anti-prostasin antibodies (such as clone 530622)

    • Pull-down assays using His-tagged recombinant prostasin

    • Surface plasmon resonance to study binding kinetics

    • Enzyme activity modulation assays with potential binding partners

  • Cell-based approaches:

    • Co-localization studies using fluorescently tagged proteins

    • Proximity ligation assays to verify protein-protein interactions

    • FRET/BRET to measure direct interactions in living cells

    • Membrane fractionation to identify compartment-specific interactions

  • Substrate identification:

    • Proteomics approaches with active vs. inactive prostasin

    • Candidate substrate screening using fluorogenic peptides

    • In-gel zymography for detection of proteolytic activity

    • Known substrates include:

      • Epithelial sodium channel (ENaC) γ-subunit

      • Toll-like receptor 4 (TLR4)

      • Potential activation of matrix metalloproteinase 14

These methodologies provide complementary information about prostasin's interaction partners and help define its functional roles in different physiological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.