Recombinant Human Protein ADORA3, isoform 3 (ADORA3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Protein ADORA3, Isoform 3

The Recombinant Human Protein ADORA3, isoform 3, refers to a specific variant of the adenosine A3 receptor, which is a G-protein-coupled receptor (GPCR) encoded by the ADORA3 gene in humans. This receptor plays a crucial role in various physiological processes, including anti-inflammatory, anticancer, and anti-ischemic effects, making it a promising therapeutic target for several diseases.

Structure and Function of ADORA3

The ADORA3 gene encodes a protein consisting of 318 amino acids, with seven transmembrane domains typical of GPCRs . The receptor is involved in signaling pathways that modulate the activity of adenylyl cyclase, phospholipase C, and intracellular calcium levels through its coupling with Gi and Gq proteins . The C-terminal segment contains numerous serine and threonine residues, which are potential sites for phosphorylation and desensitization of the receptor .

Therapeutic Potential of ADORA3

The adenosine A3 receptor is overexpressed in various neoplastic cells and inflammatory conditions, suggesting its potential as a therapeutic target . Highly selective A3AR agonists have been developed to exploit this overexpression for treating diseases such as rheumatoid arthritis, psoriasis, and certain cancers . These agonists modulate the Wnt and NF-κB signaling pathways to exert anti-inflammatory and anticancer effects .

Research Findings and Applications

Recent studies have identified novel ligands for the A3 receptor, such as N6-methyladenosine (m6A) and N6-isopentenyl adenosine (i6A), which exhibit selective agonist activity . The structural insights into the receptor's selectivity highlight the importance of hydrophobic residues in the binding pocket for agonist potency . Additionally, A3AR agonists have shown cardioprotective effects by reducing infarct size in models of ischemia/reperfusion injury .

Table 1: Expression and Therapeutic Targets of ADORA3

Disease/ConditionExpression LevelTherapeutic Potential
Cancer (e.g., leukemia, melanoma)HighAnticancer effects via modulation of signaling pathways
Inflammatory diseases (e.g., rheumatoid arthritis)HighAnti-inflammatory effects through NF-κB and Wnt pathways
Ischemic conditions (e.g., heart ischemia)VariableCardioprotective effects by reducing infarct size

Table 2: Signaling Pathways Involved in ADORA3 Activation

PathwayEffect
Gi-coupled inhibition of adenylyl cyclaseDecrease in cAMP levels
Gq-coupled activation of phospholipase CIncrease in intracellular calcium
NF-κB signalingModulation of inflammatory responses
Wnt signalingRegulation of cell proliferation and differentiation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on your needs.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Target Names
Target Protein Sequence
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR NRRVGNTLKPFSRVLTPKEMAPTEQM
Uniprot No.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.