Recombinant Human Protein ARV1 (ARV1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Protein ARV1 (ARV1)

ARV1 (ACAT related enzyme 2 required for viability 1), also known as ARV1 homolog, fatty acid homeostasis modulator, is a protein that is encoded by the ARV1 gene located at 1q42.2 in humans . This gene encodes a 271 amino acid protein . ARV1 is a transmembrane protein of the endoplasmic reticulum (ER) and contains an N-terminal zinc-binding motif in the cytosol, followed by multiple transmembrane domains, with the extreme C-terminus facing the ER lumen .

Function and Significance

ARV1 is conserved across eukaryotic species and is expressed at low levels in all tissues . Deletion of ARV1 in yeast leads to several defects, including growth and viability problems, abnormal sterol trafficking, reduced sphingolipid, glycosylphosphatidylinositol (GPI) anchor synthesis, ER stress, membrane disorganization, and hypersensitivity to fatty acids . ARV1 acts as a lipid scramblase at the endoplasmic reticulum, modulating membrane lipid asymmetry .

Role in Lipid Metabolism

ARV1 mediates sterol transport from the endoplasmic reticulum (ER) to the plasma membrane . In yeast and mammalian cells, loss of ARV1 can induce the unfolded protein response (UPR) . Yeast ARV1 mutants accumulate multiple lipids in the ER and are sensitive to pharmacological modulators of both sterol and sphingolipid metabolism .

ARV1 knockdown in HepG2 cells reduces CYP7α1 expression, consistent with in vivo findings, while also reducing SREBF1 and HMGCR expression . Arv1 may act as a central hub for directing cholesterol trafficking from the ER to various other organelles .

ARV1 Deficiency and its Consequences

Neuronal deficiency of ARV1 leads to seizures and a severe survival defect in adulthood .

Mice with a global deletion of Arv1 exhibit a lean phenotype, with major reductions in white adipose tissue mass and body weight on a chow diet . Blood cholesterol and high-density apolipoprotein levels are decreased, whereas energy expenditure rates are increased, and increased fatty acid oxidation is observed .

ARV1 and Human Diseases

Multiple human ARV1 variants have been associated with epileptic encephalopathy, cerebellar ataxia, and severe intellectual deficits .

Table 1. ARV1 Variants and Associated Pathologies

ARV1 variantGenotypeGPI-anchor DefectsPathology
c.565G > A, p.Gly189Argmissense homozygous+Epileptic encephalopathy
c.294 + 1G > A, p.Lys59_Asn98delsplicing homozygous+Infantile epileptic encephalopathy
c.674-2A > T, p.Thr266_Phe271delsplicing homozygous+Infantile epileptic encephalopathy
c.363_364del, p.Ser122Glnfs7; c.489G > A, p.Trp163compound heterozygousNSEpileptic encephalopathy
c.363_364del, pSer122Gln, fs*7homozygous frameshift+Epileptic encephalopathy
c.518dupA, p.Pro174Alafs*14; c.101G > A, p.Cys34Tyrcompound heterozygousNSEpileptic encephalopathy
c.182G > A, p.Cys61Tyrmissense homozygousNSEpileptic encephalopathy
c.674-1G > Asplicing homozygousNSEpileptic encephalopathy
c.518dupA, p.Pro174Alafs*14homozygousNSEpileptic encephalopathy
c.554_556delTAT, p.L185del-NSSeizures; intellectual disabilities

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARV1; HT035; Protein ARV1; hARV1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ARV1
Target Protein Sequence
MGNGGRSGLQQGKGNVDGVAATPTAASASCQYRCIECNQEAKELYRDYNHGVLKITICKS CQKPVDKYIEYDPVIILINAILCKAQAYRHILFNTQINIHGKLCIFCLLCEAYLRWWQLQ DSNQNTAPDDLIRYAKEWDFYRMFAIAALEQTAYFIGIFTFLWVERPMTAKKKPNFILLL KALLLSSYGKLLLIPAVIWEHDYTSVCLKLIKVFVLTSNFQAIRVTLNINRKLSFLAVLS GLLLESIMVYFFQSMEWDVGSDYAIFKSQDF
Uniprot No.

Target Background

Function

ARV1 acts as a mediator in endoplasmic reticulum (ER) cholesterol and bile acid homeostasis. It participates in sterol transport from the ER to plasma membranes.

Gene References Into Functions
  1. In contrast to wild-type human ARV1, neither variant showed detectable protein expression in mammalian cells. Mice with neuronal ARV1 deletion exhibited seizures and reduced adult survival, supporting ARV1 deficiency as a cause of autosomal recessive epileptic encephalopathy. PMID: 27270415
  2. ARV1 has a novel role in regulating cell division by promoting the contractile actomyosin ring, independent of its lipid transporter activity. PMID: 27104745
  3. Human ARV1 overexpression rescued phenotypes associated with GPI anchor synthesis defects in arv1Δ yeast mutants, suggesting conserved Arv1 function in GPI biosynthesis across eukaryotes. PMID: 26460143
  4. ARV1 acts as a protective factor against lipotoxic diseases by modulating fatty acid metabolism. PMID: 24273168
  5. Arv1p plays a role in sterol movement from the ER, regulating hepatic cholesterol and bile acid metabolism. PMID: 20663892
  6. ARV1 is involved in sphingolipid metabolism and complements yeast ARV1. PMID: 12145310
Database Links

HGNC: 29561

OMIM: 611647

KEGG: hsa:64801

STRING: 9606.ENSP00000312458

UniGene: Hs.275736

Involvement In Disease
Epileptic encephalopathy, early infantile, 38 (EIEE38)
Protein Families
ARV1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in liver and adipose.

Q&A

What is ARV1 and what is its basic structure?

Human ARV1 is a 271 amino acid transmembrane protein of the endoplasmic reticulum (ER) with several key structural features:

  • Contains a highly conserved ARV1 homology domain (AHD) at its N-terminus

  • Has a zinc-binding motif within the AHD containing two conserved cysteine clusters

  • Contains between 3-5 predicted transmembrane domains (varies by analysis method)

  • The protein's C-terminus faces the ER lumen

  • Appears to form dimers and possibly trimers in cellular contexts

The AHD is critical for function, as mutations or deletions affecting this domain result in loss of function .

What are the primary functions of ARV1 in lipid metabolism?

ARV1 plays multiple roles in cellular lipid homeostasis:

  • Directly binds cholesterol and various phospholipids with high affinity

  • Regulates sterol movement and trafficking within cells

  • May function as an energy-independent lipid scramblase at the ER

  • Modulates membrane lipid asymmetry

  • Influences glycosylphosphatidylinositol (GPI) anchor biosynthesis

  • Affects sphingolipid synthesis and trafficking

  • Serves as a potential "lipid rheostat/sensor" controlling lipid transport in response to nutrient uptake

When ARV1 function is compromised, cholesterol can accumulate in the ER, potentially disrupting multiple aspects of lipid metabolism and trafficking .

How is ARV1 protein expression analyzed in research contexts?

Researchers typically employ several complementary methods to study ARV1 expression:

  • Western blotting with epitope-tagged constructs, as ARV1 is expressed at low levels

  • RT-PCR to analyze transcript expression and splicing variants

  • Transfection of cells with ARV1 expression vectors containing N-terminal tags (e.g., 3XFLAG-HA)

  • Minigene assays to evaluate effects of mutations on splicing

  • Primary fibroblast cultures from patients to assess endogenous expression

When working with recombinant human ARV1, researchers have noted that E. coli expressed human ARV1-HIS recombinant protein purifies as monomeric, dimeric, and trimeric species, suggesting oligomerization is important for its function .

What methods are used to assess ARV1 lipid binding activity?

Several validated techniques are employed to characterize ARV1's lipid binding properties:

  • Liposome-binding assays: This highly validated method determines lipid-protein interactions by measuring binding of ARV1 to synthetic liposomes containing specific lipids

  • In vitro lipid-binding assays with recombinant protein

  • Cell-based proteomic studies using cholesterol and fatty acid bioactive probes

  • Protein-lipid overlay assays to determine binding preferences

  • Structural and biochemical analyses of the AHD domain

These methods have demonstrated that ARV1 binds several lipid species with varying affinities, including cholesterol, phospholipids, and phosphoinositides. The AHD domain and zinc-binding motif are essential for this lipid binding activity .

How do mutations in the ARV1 homology domain (AHD) affect protein function?

The AHD is critical for ARV1's function, with mutations showing distinct functional impacts:

  • Mutations affecting the zinc-binding domain and conserved cysteine clusters within the AHD abolish lipid binding

  • The 40-amino acid deletion p.(Lys59_Asn98del) which removes over half of the AHD completely prevents protein function

  • Mutations predicted to negatively affect dimerization cause weakened or complete loss of lipid binding

  • Some missense mutations (e.g., p.Gly189Arg) may produce hypomorphic proteins with partial function

  • Truncation mutations typically result in complete loss of function

In complementation studies using yeast arv1Δ, the p.(Lys59_Asn98del) variant completely failed to rescue at restrictive temperature, while p.(Gly189Arg) provided partial rescue, suggesting different degrees of functional impairment .

How has ARV1 function been studied in animal models?

Several animal models have provided insights into ARV1 function:

  • Yeast (Saccharomyces cerevisiae): Deletion of ARV1 results in growth defects, abnormal sterol trafficking, reduced sphingolipid synthesis, and ER stress

  • Mouse germline knockout models: Exhibit resistance to diet-induced obesity, altered lipid metabolism, and increased energy expenditure

  • Neuron-specific knockout mice (ARV1 NKO): Develop seizures, circling behavior, and premature death, with females showing more severe phenotypes

  • Antisense oligonucleotide knockdown studies: Reveal hypercholesterolemia and altered bile acid metabolism

Mouse models have been particularly valuable for understanding both the metabolic and neurological aspects of ARV1 function. ARV1 NKO mice recapitulate many features of human ARV1-related epileptic encephalopathy, with only 33% of female mice surviving to 20 weeks .

What is the relationship between ARV1 mutations and neurological disorders?

Multiple ARV1 variants have been linked to severe neurological conditions, with consistent features:

VariantTypeClinical ManifestationsReference
c.565G>A, p.(Gly189Arg)Homozygous missenseSevere intellectual disability, epileptic encephalopathy, ataxiaPalmer et al., 2016
c.294+1G>A, p.(Lys59_Asn98del)Homozygous splice siteSevere neurodevelopmental delay, infantile-onset seizures, death at 12 monthsPalmer et al., 2016
c.518dupA, p.Pro174Alafs*14; c.101G>A, p.Cys34TyrCompound heterozygousEpileptic encephalopathySalian et al., 2021
c.182G>A, p.Cys61TyrHomozygous missenseEpileptic encephalopathySalian et al., 2021
c.674-1G>AHomozygous splice siteEpileptic encephalopathySalian et al., 2021
c.518dupA, p.Pro174Alafs*14HomozygousEpileptic encephalopathySalian et al., 2021
c.554_556delTAT, p.L185del-Seizures, intellectual disabilitiesKarabinos et al., 2022

The pathophysiology involves defects in GPI anchor biosynthesis, with cells from patients showing reduced maturation of GPI-anchored proteins. Neuropathological examination in one case revealed atrophic brain changes, particularly affecting the cerebellum .

How does oligomerization affect ARV1 function and lipid binding?

Biochemical evidence suggests that ARV1 functions as a dimer in cells, with oligomerization being critical for its activity:

  • ARV1 purifies as monomeric, dimeric, and trimeric species

  • Mutations predicted to disrupt dimerization cause weakened or complete loss of lipid binding

  • The full-length protein and the isolated AHD domain both show lipid binding activity, but with different specificities

  • The AHD showed highest binding affinity for monophosphorylated phosphoinositides

  • Full-length ARV1 binds several phospholipids and phosphoinositides with high affinity

These findings suggest that proper protein folding and oligomerization are essential for creating the correct binding sites for various lipids, and disruption of these interactions may underlie pathological states .

What is the evidence supporting ARV1 as a lipid scramblase versus a lipid transporter?

Current research supports the hypothesis that ARV1 functions as an energy-independent lipid scramblase rather than an active transporter:

  • ARV1 acts at the ER to modulate membrane lipid asymmetry

  • It facilitates movement of lipids between membrane leaflets without energy input

  • This activity affects the trafficking of sterols and precursors for GPI anchor and sphingolipid biosynthesis

  • The protein's ability to bind multiple lipid species with different affinities supports a scramblase model

  • Complementation studies in yeast suggest conservation of this function across species

How do ARV1 defects impact GPI anchor biosynthesis?

The relationship between ARV1 and GPI anchor biosynthesis appears to be critical for understanding its role in neurological disorders:

  • Human ARV1 suppresses GPI biosynthesis defects in Scarv1Δ yeast cells

  • Mutations in human ARV1 linked to infantile seizure disorders lead to defects in GPI biosynthesis

  • Cells from patients with ARV1 mutations show reduced maturation of GPI-anchored proteins

  • Neuronal GPI-anchored proteins play pivotal roles in central nervous system development

  • The p.Gly189Arg variant cannot suppress GPI biosynthesis defects in yeast, as evidenced by decreased maturation of the GPI-anchored Gas1 protein

Whether ARV1 has a direct or indirect effect on GPI anchor biosynthesis remains unsettled. Only limited complementation studies have been performed to test the ability of human ARV1 variants to suppress specific aspects of the yeast arv1Δ phenotype .

What cellular models are most appropriate for studying recombinant ARV1 function?

Several cellular models have been used effectively to study ARV1 function:

  • Yeast (S. cerevisiae): Excellent for complementation studies and basic functional analysis

  • HEK293T cells: Used for transfection studies with tagged ARV1 constructs

  • HepG2 cells: Valuable for studying ARV1's role in cholesterol and lipid metabolism

  • Primary fibroblasts from patients: Essential for analyzing effects of mutations on endogenous ARV1

  • Neuronal cultures: Important for understanding ARV1's role in neurological function

When selecting a model system, researchers should consider which aspect of ARV1 function they wish to study and the conservation of relevant pathways in their chosen model .

What are the challenges in expressing and purifying recombinant human ARV1?

Researchers working with recombinant human ARV1 face several technical challenges:

  • Low endogenous expression levels necessitate use of overexpression systems

  • Multiple transmembrane domains create folding and solubility issues

  • Proper formation of the zinc-binding domain requires appropriate redox conditions

  • ARV1 exists in multiple oligomeric states that may have different functions

  • Some mutations destabilize the protein, making expression of mutant variants difficult

  • The protein's interactions with membrane lipids complicate purification strategies

Addition of epitope tags (e.g., HIS, FLAG) can facilitate purification, though care must be taken to verify that tags don't disrupt function .

How should researchers design experiments to characterize novel ARV1 variants?

A comprehensive approach to characterizing novel ARV1 variants should include:

  • Computational analysis: Predict effects on protein structure and conservation across species

  • Expression analysis: Determine whether the variant affects protein expression levels

  • Localization studies: Confirm proper ER localization of the variant protein

  • Functional complementation: Test ability to rescue phenotypes in yeast arv1Δ cells

  • Lipid binding assays: Assess binding to cholesterol, phospholipids, and other lipids

  • GPI anchor biosynthesis: Examine effects on GPI-anchored protein maturation

  • Sterol trafficking: Evaluate cholesterol distribution in cells expressing the variant

  • Oligomerization analysis: Determine whether the variant affects protein dimerization

This multi-faceted approach provides a more complete picture of how variants affect the various functions of ARV1 .

What recent advances have been made in understanding ARV1's role in lipid homeostasis?

Recent research has clarified several aspects of ARV1 function:

  • Direct demonstration of ARV1's ability to bind cholesterol and phospholipids in vitro

  • Identification of the AHD as the primary lipid-binding domain

  • Recognition of ARV1 as a potential lipid "rheostat/sensor" controlling lipid transport

  • Understanding the role of ARV1 in neurological development and function

  • Characterization of ARV1's role in modulating whole-body metabolism through both liver and neuronal functions

  • Evidence supporting ARV1 as an energy-independent lipid scramblase

These findings have shifted the understanding of ARV1 from a putative lipid transporter to a protein that modulates membrane lipid asymmetry, with implications for multiple cellular processes .

What are the most promising directions for future ARV1 research?

Several key areas warrant further investigation:

  • Detailed structural studies of ARV1, particularly the lipid-binding pocket

  • Direct biochemical demonstration of scramblase activity

  • Development of specific small molecule modulators of ARV1 function

  • Further characterization of ARV1's role in neuronal development and function

  • Investigation of potential therapeutic approaches for ARV1-related disorders

  • Exploration of the relationship between ARV1's various functions (sterol trafficking, GPI biosynthesis, sphingolipid metabolism)

  • Understanding the tissue-specific effects of ARV1 deficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.