Recombinant Human Protein ATP1B4 (ATP1B4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Protein ATP1B4 (ATP1B4)

Recombinant Human Protein ATP1B4, also known as ATPase Na+/K+ transporting family member beta 4, is a protein encoded by the ATP1B4 gene in humans . This protein is a plasma membrane-bound beta-subunit of Na,K-ATPase, playing diverse roles depending on the organism . In lower vertebrates, it functions as a component of ion pumps in the plasma membrane, while in placental mammals, it has evolved to participate in transcriptional regulation during muscle development .

Gene and Protein Structure

The ATP1B4 gene is located on chromosome X in humans . The protein sequence can be found in the UniProt database under the accession number Q9UN42 . The Human Protein Atlas provides detailed structural information for ATP1B4 .

Evolutionary Significance and Function

ATP1B4 showcases a rare instance of vertebrate gene co-option, leading to significantly different functions of the encoded BetaM proteins .

  • Lower Vertebrates: Functions as a typical Na, K-ATPase β-subunit in the plasma membrane .

  • Placental Mammals: It has transitioned from its ancestral role to become a skeletal and cardiac muscle-specific protein located in the inner nuclear membrane, highly expressed during late fetal and early postnatal development . It interacts with the transcriptional co-regulator SNW1/SKIP and regulates muscle gene expression by promoting changes in chromatin structure .

Role in Muscle Development

In placental mammals, ATP1B4 (BetaM) plays a critical role during the perinatal development of skeletal muscle . It directly interacts with the transcriptional co-regulator SKIP, influencing gene expression . BetaM can stimulate the expression of the muscle regulatory factor (MRF), MyoD, independently of SKIP. It binds to the distal regulatory region (DRR) of MyoD, promoting epigenetic changes associated with the activation of transcription and recruits the SWI/SNF chromatin remodeling subunit, BRG1 .

Tissue Distribution

ATP1B4 is expressed in various tissues, with notable presence in the brain . Extended tissue profiling is available in the Human Protein Atlas .

Genetic Variations

Several variants of the ATP1B4 gene have been identified, some of which are associated with germline mutations . These variants are cataloged in databases such as the Global Variome shared Leiden Open Variation Database (LOVD) .

Table of ATP1B4 Variants

VariantNucleotide ChangeAmino Acid ChangeClassification
ATP1B4_000018c.133G>Ap.(Val45Met)VUS
ATP1B4_000023c.261G>Ap.(=)Likely Benign
ATP1B4_000024c.303T>Gp.(Phe101Leu)Likely Benign
ATP1B4_000004c.563-141delp.(=)VUS
ATP1B4_000025c.608C>Tp.(Pro203Leu)Likely Benign
ATP1B4_000009c.671G>A
ATP1B4_000012c.759+292C>Ap.(=)VUS
ATP1B4_000001c.760-91C>Gp.(=)VUS
ATP1B4_000026c.865G>Tp.(Ala289Ser)Likely Benign
ATP1B4_000021c.922A>Tp.(Thr308Ser)Likely Benign/VUS
ATP1B4_000027c.979G>Cp.(Val327Leu)Likely Benign

Note: VUS = Variant of Unknown Significance

Involvement in Diseases

While specific diseases directly linked to ATP1B4 mutations are not extensively documented, its role in cellular processes suggests potential involvement in conditions related to muscle development and cancer . Research indicates that APE1, which interacts with ATP1B4, is linked to cancer resistance .

Interactions with Other Proteins

ATP1B4 interacts with several proteins, including:

  • SNW1/SKIP: Functions as a transcriptional co-regulator during muscle development .

  • MyoD: BetaM binds to the distal regulatory region (DRR) of MyoD, influencing muscle gene expression .

  • BRG1: Recruits the SWI/SNF chromatin remodeling subunit, BRG1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your required tag type for prioritized development.
Synonyms
ATP1B4; Protein ATP1B4; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEK EEEEEEEKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFY ASLAAVITLCMYTLFLTISPYIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVI SLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGY STGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYG KLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLNIET
Uniprot No.

Target Background

Function
ATP1B4 may function as a transcriptional coregulator during muscle development via interaction with SNW1. It has lost its ancestral role as a Na,K-ATPase beta-subunit.
Gene References Into Functions
  1. A coding region variant in the ATP1B4 gene may have minimal or no impact on Parkinson's Disease development in the Chinese Han population. PMID: 24420862
Database Links

HGNC: 808

KEGG: hsa:23439

STRING: 9606.ENSP00000218008

UniGene: Hs.292599

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein.
Tissue Specificity
Highly expressed in skeletal muscle and at a lower level in heart.

Q&A

What is ATP1B4 and how has its function evolved across vertebrate species?

The protein's structural evolution includes the acquisition of an extended glutamate-rich N-terminal domain in placental mammals, which contributes to its nuclear localization and regulatory functions . These modifications allowed ATP1B4 to transition from membrane ion transport to transcriptional regulation, particularly in developing muscle tissue.

What are the key structural characteristics of human ATP1B4?

Human ATP1B4 is a 357 amino acid protein with the following key structural features:

Basic Information of ATP1B4Data
Protein NameATP1B4
Gene NameATP1B4
AliasesX, K-ATPase subunit beta-m, X/potassium-transporting ATPase subunit beta-m
OrganismHomo sapiens (Human)
UniProt IDQ9UN42
Transmembrane Regions1
Length (amino acids)357
SequenceMRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLTISPYIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLNIET

A distinguishing structural feature of mammalian ATP1B4 is its extended glutamate-rich N-terminal domain, which is critical for its nuclear localization and interaction with transcriptional coregulators . The protein retains a single transmembrane domain despite its functional transition from membrane to nuclear protein, suggesting structural conservation despite functional divergence.

What expression patterns does ATP1B4 display during development?

ATP1B4 shows distinct temporal and tissue-specific expression patterns that provide insights into its biological function. The highest expression levels are observed during late fetal and early postnatal development, particularly in myocytes . This temporal expression profile suggests that ATP1B4 plays a critical role in perinatal muscle development.

In placental mammals, ATP1B4 expression is largely restricted to skeletal and cardiac muscle tissues, where it localizes to the inner nuclear membrane . The protein's expression gradually decreases in mature muscle tissue, indicating its primary function may be in developmental processes rather than maintenance of adult muscle physiology.

Research methodologies for studying developmental expression patterns include:

  • Quantitative PCR for temporal expression profiling

  • Immunohistochemistry for tissue localization

  • Reporter gene constructs to track expression in model organisms

  • Single-cell RNA sequencing to identify cell-specific expression

How does ATP1B4 function as a transcriptional coregulator?

In placental mammals, ATP1B4 has evolved to function as a transcriptional coregulator, particularly during muscle development. Research indicates that it interacts with SNW1 (SNW domain-containing protein 1), a nuclear transcriptional coregulator involved in the regulation of transforming growth factor beta (TGF-beta) signaling pathways .

The methodological approach to studying this function involves:

  • Co-immunoprecipitation assays to confirm protein-protein interactions

  • Chromatin immunoprecipitation (ChIP) to identify genomic binding regions

  • Reporter gene assays to quantify transcriptional effects

  • Proximity ligation assays to visualize protein interactions in situ

ATP1B4 appears to participate in the regulation of gene expression programs essential for proper muscle development and maturation. This function represents a complete departure from its ancestral role in ion transport, demonstrating how evolutionary processes can repurpose existing proteins for entirely new cellular functions.

What are the metabolic consequences of ATP1B4 ablation in animal models?

Recent research using ATP1B4 knockout mice has revealed surprising metabolic phenotypes. Beta-M deficient (Atp1b4-/Y) mice exhibit:

  • Significantly lower body weight

  • Remarkably low adiposity

  • Lower fasting blood glucose levels

  • Enhanced insulin sensitivity

  • Improved glucose tolerance

  • Higher heat production

  • Increased food intake

  • Elevated oxygen consumption (especially during dark periods)

  • Higher locomotor activity

  • Lower respiratory exchange ratio (indicating preferential fat metabolism)

These findings suggest that ATP1B4 plays a previously unrecognized role in regulating metabolism in adult mice. The ablation of ATP1B4 appears to protect against obesity and enhance metabolic function, potentially through alterations in energy expenditure and substrate utilization .

Researchers investigating these metabolic effects should consider the following methodological approaches:

  • Comprehensive metabolic phenotyping

  • Glucose and insulin tolerance testing

  • Indirect calorimetry for energy expenditure

  • Molecular analysis of metabolic tissues

  • Transcriptomic and proteomic profiling

How can evolutionary insights into ATP1B4 function inform research approaches?

The evolutionary repurposing of ATP1B4 from an ion transport protein to a nuclear transcriptional regulator represents a unique opportunity to study evolutionary co-option in mammals. According to recent research, ablation of Atp1b4 essentially simulates a scenario where a specific stage in mammalian evolution is bypassed . This provides a valuable model for understanding how evolutionary changes in protein function contribute to species-specific phenotypes.

Research methodologies leveraging this evolutionary perspective include:

  • Comparative genomics across vertebrate species

  • Functional analysis of ATP1B4 orthologs from different species

  • Generation of chimeric proteins combining domains from different species

  • Rescue experiments in knockout models using orthologs from different species

Interestingly, the metabolic phenotype observed in Atp1b4 knockout mice suggests that bypassing the co-option of ATP1B4 potentially reduces susceptibility to obesity . This finding provides a novel perspective on how evolutionary adaptations may influence disease susceptibility in modern environments.

What expression systems are optimal for producing recombinant ATP1B4 protein?

Several expression systems have been successfully employed for producing recombinant ATP1B4 protein, each with distinct advantages depending on the research application:

Expression SystemAdvantagesConsiderationsApplications
HEK-293 CellsMammalian post-translational modifications, proper foldingHigher cost, lower yieldFunctional studies, protein-protein interactions
Escherichia coliHigh yield, cost-effective, scalableLacks post-translational modificationsStructural studies, antibody production
BaculovirusEukaryotic post-translational modifications, high yieldMore complex than bacterial systemsBiochemical characterization, enzymatic assays
YeastEukaryotic processing, moderate yieldSome differences in glycosylationProtein-protein interactions, functional studies

For studies investigating ATP1B4's nuclear functions and interactions with transcriptional machinery, mammalian expression systems are generally preferred as they provide the proper cellular environment for post-translational modifications and protein folding . Researchers should select the expression system based on the specific requirements of their experimental design, considering factors such as protein yield, post-translational modifications, and functional integrity.

What techniques are most effective for studying ATP1B4's subcellular localization?

The dramatic shift in ATP1B4's subcellular localization from the plasma membrane in lower vertebrates to the inner nuclear membrane in placental mammals represents a key aspect of its functional evolution. Studying this localization requires specialized techniques:

  • Immunofluorescence microscopy with co-localization markers for:

    • Nuclear envelope (lamin proteins)

    • Inner nuclear membrane (emerin, LAP2)

    • Plasma membrane (Na+/K+-ATPase α-subunit)

  • Subcellular fractionation with Western blotting

    • Nuclear, cytoplasmic, and membrane fractions

    • Differential detergent extraction for membrane subdomains

  • Electron microscopy with immunogold labeling

    • Ultra-structural localization in different cell types

    • Species-specific differences in localization

  • Live-cell imaging with fluorescently tagged proteins

    • Dynamics of localization during development

    • Response to cellular stressors or stimuli

These methodological approaches can be combined to provide complementary data on ATP1B4's subcellular distribution and how it relates to function in different species and developmental stages.

How can researchers effectively study the involvement of ATP1B4 in the integrated stress response?

Recent research has identified connections between mitochondrial function, stress responses, and nuclear gene regulation that may involve ATP1B4. The integrated stress response (ISR) involves activating transcription factor 4 (ATF4) as a key regulator of cellular stress adaptation . Given ATP1B4's nuclear localization and role in transcriptional regulation, investigating potential connections to the ISR represents an important research direction.

Methodological approaches include:

  • Gene expression analysis following cellular stressors

    • Quantitative PCR for stress response genes

    • RNA sequencing for global transcriptional changes

    • ChIP-seq for identifying binding sites

  • Protein interaction studies

    • Co-immunoprecipitation with ATF4 and other stress response factors

    • Proximity ligation assays in stressed and unstressed cells

    • Yeast two-hybrid screening for novel interaction partners

  • Functional assays

    • Reporter gene assays for ISR-responsive elements

    • CRISPR-mediated gene editing to assess functional requirements

    • Metabolic analyses under stress conditions

Understanding ATP1B4's potential role in stress responses could provide valuable insights into its evolved functions in placental mammals and potential connections to metabolic regulation.

What is the evidence linking ATP1B4 to human disease?

ATP1B4 has been implicated in several pathological conditions, although the mechanisms remain incompletely understood. Current evidence suggests associations with:

  • Congenital anomalies of kidney and urinary tract 2

    • Potential developmental roles in kidney formation

    • Altered gene regulation during organogenesis

  • Thyrotoxic periodic paralysis

    • Possible involvement in muscle excitability

    • Connections to ion homeostasis despite functional transition

  • Metabolic disorders

    • Knockout studies indicate protection against obesity

    • Enhanced glucose homeostasis in ATP1B4-deficient mice

Research methodologies for investigating these disease connections include:

  • Genetic association studies in patient populations

  • Functional characterization of disease-associated variants

  • Animal models of ATP1B4 dysfunction

  • Tissue-specific conditional knockout approaches

How might ATP1B4 represent a therapeutic target for metabolic disorders?

The striking metabolic phenotype observed in ATP1B4 knockout mice suggests potential therapeutic applications for targeting this protein in metabolic disorders. Mice lacking ATP1B4 show protection against obesity, enhanced insulin sensitivity, and improved glucose tolerance , indicating that inhibition of ATP1B4 function might provide metabolic benefits.

Methodological approaches for therapeutic development include:

  • High-throughput screening for small molecule inhibitors

    • Disruptors of protein-protein interactions

    • Modulators of nuclear localization

    • Regulators of expression or stability

  • Antisense oligonucleotides or siRNA approaches

    • Tissue-specific delivery systems

    • Temporal control of inhibition

    • Dose-response characterization

  • Structure-based drug design

    • Targeting specific functional domains

    • Rational design based on interaction interfaces

  • Validation in disease models

    • Diet-induced obesity

    • Genetic models of insulin resistance

    • Pharmacokinetic/pharmacodynamic relationships

The evolutionary co-option of ATP1B4 in placental mammals presents an intriguing target, as inhibiting its acquired functions might restore metabolic characteristics that existed prior to this evolutionary change . This approach represents a novel perspective in metabolic disease therapy, essentially "reversing" a specific evolutionary adaptation that may contribute to susceptibility to modern metabolic diseases.

What are the key unanswered questions regarding ATP1B4 function?

Despite significant advances in understanding ATP1B4, several important questions remain:

  • What is the complete set of transcriptional targets regulated by ATP1B4?

    • Genome-wide binding profiles

    • Cell-type specific regulatory networks

    • Temporal dynamics during development

  • How does ATP1B4 interact with the broader transcriptional machinery?

    • Composition of regulatory complexes

    • Chromatin remodeling activities

    • Epigenetic modifications

  • What signals regulate ATP1B4 expression and activity?

    • Developmental cues

    • Metabolic signals

    • Stress responses

  • How do post-translational modifications affect ATP1B4 function?

    • Phosphorylation states

    • Ubiquitination and stability

    • Other modifications

  • What are the molecular mechanisms underlying ATP1B4's effects on metabolism?

    • Direct transcriptional targets

    • Tissue-specific roles

    • Systemic metabolic integration

What technologies are emerging as valuable for ATP1B4 research?

Several cutting-edge technologies are particularly promising for advancing ATP1B4 research:

  • CRISPR-based approaches

    • Precise genome editing for functional studies

    • CRISPRi/CRISPRa for modulating expression

    • Base editing for studying specific variants

  • Single-cell technologies

    • scRNA-seq for expression profiling in heterogeneous tissues

    • Spatial transcriptomics for tissue context

    • Single-cell proteomics for protein-level analysis

  • Cryo-electron microscopy

    • Structural determination of ATP1B4 complexes

    • Visualization of interaction interfaces

    • Conformational dynamics

  • Proteomics approaches

    • Interaction proteomics for comprehensive binding partners

    • Post-translational modification mapping

    • Protein turnover and dynamics

  • Metabolomics

    • Comprehensive metabolic profiling in knockout models

    • Flux analysis for metabolic pathways

    • Integration with transcriptomics data

These technologies, particularly when applied in combination, promise to provide deeper insights into ATP1B4's evolved functions and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.