Recombinant Human Protein CLN8 (CLN8)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Human Protein CLN8 (CLN8) is a transmembrane protein encoded by the CLN8 gene located on chromosome 8. It belongs to the TRAM-LAG1-CLN8 domain (TLCD) family, which includes enzymes critical for phospholipid remodeling and membrane homeostasis . CLN8 is expressed in the endoplasmic reticulum (ER) and ER-Golgi intermediate compartment (ERGIC), where it functions as both an enzymatic acyltransferase and a cargo receptor for lysosomal enzyme trafficking .

Enzymatic Role in Phospholipid Metabolism

CLN8 is a lysophosphatidylglycerol acyltransferase that catalyzes the formation of R,S-bis(monoacylglycero)phosphate (BMP), a precursor to S,S-BMP, a lysosomal phospholipid critical for lysosome integrity .

Key Steps in BMP Biosynthesis

  1. Acyltransferase Activity: CLN8 transfers acyl groups from CoA to LPG, forming R,S-BMP.

  2. Stereoisomerization: An unidentified enzyme rearranges R,S-BMP to S,S-BMP via phosphoryl ester migration .

  3. Lysosomal Enzyme Support: S,S-BMP is required for lysosomal enzyme stability and function .

Clinical Relevance: Batten Disease

Mutations in CLN8 cause neuronal ceroid lipofuscinosis type 8 (NCL8), a fatal lysosomal storage disorder characterized by progressive neurodegeneration, seizures, and retinopathy .

Pathological FeatureMechanism
Lysosomal DysfunctionLoss of BMP leads to impaired lysosomal enzyme trafficking and degradation .
AstrocytosisElevated glial fibrillary acidic protein (GFAP) in Cln8-deficient mice .
Therapeutic TargetGene therapy with AAV9 vectors restores CLN8 expression and extends lifespan .

Lipidomics and Enzyme Activity

  • CLN8 KO Cells: Near-complete loss of BMP species in HeLa and U-2OS cells, restored by CLN8-HA transfection .

  • Substrate Preference: CLN8 shows higher activity with linoleoyl-CoA and DHA-CoA compared to saturated fatty acids .

SubstrateProductEfficiency
18:1-LPG + Oleoyl-CoAR,S-BMPHigh (time-dependent)
18:1-LPG + DHA-CoAR,S-BMPHighest preference

Gene Therapy Outcomes

  • AAV9-Mediated Delivery: Sustained hCLN8 expression in cerebral cortex, thalamus, and spinal cord of Cln8-deficient mice .

  • Pathological Rescue: Reduced astrocytosis (GFAP immunoreactivity) and extended lifespan in treated mice .

Interactions and Complex Formation

CLN8 forms the EGRESS complex with CLN6, an ER-associated protein. This complex recruits lysosomal enzymes (e.g., cathepsin D) at the ER for Golgi transfer via COPII vesicles .

ComponentRole
CLN6Binds lysosomal enzymes via luminal loop; retained in ER .
CLN8Traffics to Golgi via COPII; recycles via COPI vesicles .

Therapeutic and Diagnostic Applications

  • Gene Therapy: scAAV9 vectors targeting CLN8 show promise in preclinical models .

  • Biomarker Potential: BMP levels and GFAP immunoreactivity may serve as diagnostic indicators .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CLN8; C8orf61; Protein CLN8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CLN8
Target Protein Sequence
MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLNATYRSLVARE KVFWDLAATRAVFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVA VHLSNLIFRTFDLFLVIHHLFAFLGFLGCLVNLQAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLTLFLVGLAL LTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQLLRKKRP
Uniprot No.

Target Background

Function
CLN8 protein may play a role in cell proliferation during neuronal differentiation and in protection against cell death.
Gene References Into Functions
  1. CLN8 facilitates the recruitment of lysosomal soluble proteins from the endoplasmic reticulum (ER) to the Golgi apparatus via COPII-coated vesicles. It then recycles back to the ER via COPI-coated vesicles. CLN8 interacts with these proteins through its large luminal loop. The export signal of CLN8 (261VDWNF265) is located in its cytosolic C-terminus. A deficiency in CLN8 results in depletion of enzymes at the lysosome. PMID: 30397314
  2. Whole-exome sequencing and homozygosity mapping identified a novel homozygous CLN8 mutation, c.677T>C (p.Leu226Pro), in five relatives from a large Turkish consanguineous family. PMID: 27844444
  3. A novel missense mutation in CLN8 was identified in late infantile neuronal ceroid lipofuscinosis. PMID: 26443629
  4. This study does not support a contribution of rare missense CLN8 variations to autism spectrum disorder (ASD) susceptibility in the Japanese population. PMID: 26657971
  5. This study highlights a close interaction between CLN5 and CLN8 proteins and their role in sphingolipid metabolism. Our findings suggest that CLN5p/CLN8p likely act as positive modulators of CerS1 and/or CerS2. PMID: 23160995
  6. A missense mutation at the CLN8 gene (763C>G) has been identified in three consanguineous Israeli-Arab patients. The phenotype in two of them is milder than that of their cousin, who exhibits typical neuronal ceroid lipofuscinosis. PMID: 22964447
  7. CLN8 is a candidate modifier gene for GM1 gangliosidosis (GD1). Increased expression may protect against severe GD1. It may function as a protective sphingolipid sensor and/or in glycosphingolipid trafficking. PMID: 22388998
  8. A novel, large CLN8 gene deletion c.544-2566_590del2613 was described in a Turkish family with a slightly more severe phenotype of neuronal ceroid lipofuscinose. PMID: 19807737
  9. Patients with CLN8 mutations from Italy exhibited an onset of epilepsy between 3 and 6 years of age, with myoclonic, tonic-clonic, and atypical absence seizures. Electroencephalograms revealed focal and/or generalized abnormalities. PMID: 17129765
  10. CLN8 plays a role in cell proliferation during neuronal differentiation and in protection against cell death. PMID: 19431184

Show More

Hide All

Database Links

HGNC: 2079

OMIM: 600143

KEGG: hsa:2055

STRING: 9606.ENSP00000328182

UniGene: Hs.127675

Involvement In Disease
Ceroid lipofuscinosis, neuronal, 8 (CLN8); Ceroid lipofuscinosis, neuronal, 8, Northern epilepsy variant (CLN8NE)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is the structural characterization of recombinant human CLN8 protein?

CLN8 is an endoplasmic reticulum (ER) membrane protein containing a TRAM-LAG1-CLN8 domain (TLCD) with multiple transmembrane regions. AlphaFold2-predicted structural analysis reveals conserved TLCD family residues that are essential for its acyltransferase activity, particularly surrounding the lysophosphatidylglycerol (LPG) headgroup binding site .

For structural characterization of recombinant CLN8, researchers should consider:

  • X-ray crystallography or cryo-EM after stabilization with appropriate detergents

  • Site-directed mutagenesis of conserved residues (particularly H139, R204) to validate functional domains

  • Topology mapping using protease protection assays to confirm membrane orientation

  • Analysis of the second luminal loop (amino acids 251-329), which is necessary for interaction with lysosomal enzymes

What expression systems are most effective for producing functional recombinant human CLN8?

Mammalian expression systems yield the most functional recombinant CLN8 due to their ability to provide proper post-translational modifications and membrane integration capabilities.

Recommended methodology:

  • Use HEK293 or CHO cell lines for large-scale production

  • Employ a tag system (HA-, myc-, or His-tag) for purification while ensuring tag position doesn't interfere with function

  • Confirm proper localization to ER/Golgi membranes via immunofluorescence microscopy

  • Validate functionality through enzymatic assays (acyltransferase activity) and interaction studies with lysosomal enzymes

CLN8 expression in HeLa and U-2OS cells has been successfully demonstrated, with functional validation through complementation of CLN8 knockout cells .

How can the enzymatic activity of recombinant CLN8 be assessed in vitro?

CLN8 functions as a lysophosphatidylglycerol acyltransferase that catalyzes the formation of bis(monoacylglycero)phosphate (BMP) through headgroup acylation of LPG .

Recommended acyltransferase assay protocol:

  • Substrate preparation: Use 18:1-LPG as primary substrate with radiolabeled [1-14C]-oleoyl-CoA or unlabeled acyl-CoA donors

  • Reaction conditions: Optimize buffer (pH 7.2-7.4), temperature (37°C), and incubation time (30-60 minutes)

  • Product detection:

    • Thin-layer chromatography (TLC) using R,S-dioleoyl-BMP standards as migration references

    • LC-MS/MS detection monitoring BMP-specific monoacylglycerol fragment transitions

  • Substrate preference analysis: Test with equimolar acyl-CoA mixtures to determine fatty acid preferences (CLN8 shows preference for polyunsaturated linoleoyl-CoA (18:2) and docosahexaenoic acid-CoA (DHA-CoA))

Acyl-CoA SubstrateRelative Activity
Linoleoyl-CoA (18:2)+++++
DHA-CoA (22:6)++++
Oleoyl-CoA (18:1)+++
Palmitoyl-CoA (16:0)++

What are the key CLN8 interactions with lysosomal enzymes and how can these be studied?

CLN8 serves as an ER cargo receptor that interacts with approximately two-thirds of lysosomal enzymes, facilitating their transport from the ER to the Golgi complex .

Methods to study CLN8-lysosomal enzyme interactions:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Co-transfect cells with Y2-CLN8 and lysosomal enzymes tagged with complementary YFP fragments

    • Quantify interactions via flow cytometry

    • Perform parallel negative controls with non-lysosomal proteins

  • Co-immunoprecipitation:

    • Transfect cells with CLN8-myc and target lysosomal enzymes

    • Immunoprecipitate using anti-myc antibodies

    • Detect interactions by immunoblotting with enzyme-specific antibodies

  • Domain mapping:

    • Generate CLN8 constructs lacking the second luminal loop (CLN8ΔL)

    • Test interaction disruption with BiFC assays

    • Test disease-causing mutations (particularly those in the second luminal loop) for their effect on enzyme binding

How can CRISPR-Cas9 be used to generate CLN8 knockout models?

CLN8 knockout models are essential for studying protein function and disease mechanisms.

Recommended CRISPR-Cas9 protocol:

  • Guide RNA design:

    • Target conserved early exons to ensure complete loss of function

    • Use multiple gRNAs to increase knockout efficiency

    • Verify minimal off-target effects using predictive algorithms

  • Cell line selection:

    • HeLa and U-2OS cells have been successfully used for CLN8 knockout studies

    • Consider neuronal cell lines for neurodegenerative disease relevance

  • Validation of knockout:

    • Genomic verification: PCR and sequencing of target region

    • Protein verification: Immunoblotting for CLN8

    • Functional verification: Lipidomic analysis showing absence of BMP species

    • Rescue experiments: Complementation with wild-type CLN8-HA to restore BMP levels

How do specific disease-causing mutations affect the acyltransferase activity of recombinant CLN8?

Several pathogenic mutations in CLN8 have been identified in patients with Batten disease, particularly affecting conserved histidine and arginine residues (H139Y, R204C, and R204L) .

Methodological approach to studying mutant CLN8:

  • Site-directed mutagenesis:

    • Generate recombinant CLN8 constructs with specific disease mutations

    • Express and purify mutant proteins using mammalian expression systems

  • Enzyme kinetics analysis:

    • Measure Km and Vmax parameters for wild-type and mutant CLN8

    • Compare substrate preferences using equimolar acyl-CoA mixtures

  • Structural impact assessment:

    • Perform molecular docking simulations of LPG binding to wild-type and mutant CLN8

    • Map mutations onto the AlphaFold2-predicted structure to visualize potential disruptions

  • Functional rescue experiments:

    • Test whether mutant CLN8 can restore BMP levels in CLN8 knockout cells

    • Quantify degree of functional impairment for each mutation

What is the relationship between CLN8's role as a cargo receptor and its acyltransferase activity?

CLN8 has a dual function: it serves as a cargo receptor for lysosomal enzymes and as an acyltransferase in BMP synthesis .

Experimental approaches to dissect these functions:

  • Domain separation studies:

    • Generate CLN8 variants with mutations that specifically affect either function

    • The second luminal loop is critical for lysosomal enzyme interactions

    • Conserved TLCD residues are essential for acyltransferase activity

  • Temporal analysis:

    • Determine if cargo binding and enzymatic activity occur simultaneously or sequentially

    • Investigate if substrate binding affects cargo interactions

  • Subcellular localization studies:

    • Track CLN8 trafficking between ER and Golgi

    • Determine where and when enzymatic activity occurs in relation to cargo binding

  • Interaction proteomics:

    • Identify proteins that interact with CLN8 during different functional states

    • Map interaction networks specific to each function

What is the proposed mechanism of BMP synthesis involving CLN8?

CLN8 catalyzes a critical step in the biosynthesis of bis(monoacylglycero)phosphate (BMP), a phospholipid essential for lysosomal function .

The complete BMP synthesis pathway:

  • CLN8 catalyzes the acylation of R,S-LPG in the ER/Golgi to produce R,S-BMP intermediate

  • This R,S-BMP undergoes phosphoryl ester migration from the sn-3 to sn-1 position, releasing the sn-1 linked acyl chain

  • This migration, catalyzed by an unidentified enzyme, produces S,S-LPG intermediate

  • S,S-LPG is trafficked to lysosomes where CLN5 (another Batten disease-related protein) uses it to generate mature S,S-BMP

This pathway explains why:

  • Fatty acyl-CoA synthesis is necessary for BMP biosynthesis

  • BMP formation involves removal of both acyl groups while retaining both glycerol moieties from precursor phosphatidylglycerol

  • CLN8-deficient cells show near-complete absence of BMP species

![BMP Synthesis Pathway]

StepEnzymeSubstrateProductLocation
1CLN8R,S-LPG + Acyl-CoAR,S-BMPER/Golgi
2UnknownR,S-BMPS,S-LPGUnknown
3CLN5S,S-LPGS,S-BMPLysosome

How does CLN8 deficiency affect global cellular lipidome beyond BMP species?

While CLN8 deficiency most dramatically affects BMP levels, broader lipidomic analyses reveal additional impacts.

Comprehensive lipidomic analysis approach:

  • Sample preparation:

    • Compare wild-type, CLN8 knockout, and CLN8-reconstituted cells

    • Fractionate samples to separate different cellular compartments

  • Analytical methods:

    • LC-MS/MS-based lipidomics for comprehensive lipid profiling

    • Targeted analysis of lysophospholipids and their acylated products

  • Data interpretation:

    • Look for accumulation of precursors (e.g., LPG)

    • Identify compensatory changes in related lipid species

    • Map changes to specific metabolic pathways

Notable observations include:

  • Near-complete absence of BMP species in CLN8-deficient cells

  • Cell type-specific BMP profiles (U-2OS cells show enrichment in DHA-containing BMP species compared to HeLa cells)

  • CLN8 deficiency may affect other phospholipid classes through indirect mechanisms

What methodologies can distinguish between CLN8's role in phosphatidylglycerol (PG) versus BMP synthesis?

Since LPG can be acylated to form either phosphatidylglycerol (PG) or BMP, distinguishing between these reaction products is crucial.

Recommended differentiation techniques:

  • Thin-layer chromatography (TLC):

    • Use R,S-dioleoyl-BMP standards to identify BMP-specific migration patterns

    • Compare migration with PG standards to differentiate products

  • Mass spectrometry:

    • Monitor BMP-specific monoacylglycerol fragment transitions by LC-MS/MS

    • Analyze fragmentation patterns characteristic of BMP versus PG

  • Stereochemical analysis:

    • BMP has a unique stereochemistry with phosphate groups at the sn-1 positions of both glycerol moieties

    • PG has the phosphate at the typical sn-3 position

  • Selective inhibition:

    • Use inhibitors specific to either BMP or PG synthesis pathways

    • Monitor differential effects on lipid production

Research demonstrates that purified CLN8 preferentially synthesizes BMP in time-dependent assays with 18:1-LPG and radiolabeled acyl-CoA donors .

What therapeutic strategies could target CLN8 for Batten disease treatment?

Given that CLN8 mutations cause a form of Batten disease, therapeutic approaches targeting this protein represent a promising avenue for treatment.

Potential therapeutic strategies:

  • Gene therapy approaches:

    • AAV-mediated delivery of functional CLN8 to affected tissues, particularly the CNS

    • Gene editing to correct specific mutations using CRISPR-based technologies

  • Small molecule development:

    • High-throughput screening for compounds that enhance residual CLN8 function

    • Chaperone therapies to improve folding of misfolded CLN8 mutants

    • Substrate reduction therapy targeting BMP precursors

  • Bypass strategies:

    • Identification of alternative enzymes that could compensate for CLN8 function

    • Direct BMP supplementation strategies

  • Combination therapies:

    • Targeting both CLN8's acyltransferase activity and cargo receptor functions

    • Addressing secondary consequences of CLN8 deficiency

How can recombinant CLN8 be used to screen for potential inhibitors or activators?

High-throughput screening platforms using recombinant CLN8 could identify compounds that modulate its activity.

Screening methodology recommendations:

  • Primary enzymatic assays:

    • Fluorescence-based detection of acyltransferase activity

    • Measure BMP formation using LC-MS/MS in miniaturized format

  • Secondary cell-based assays:

    • CLN8 knockout cells complemented with wild-type or mutant CLN8

    • Monitor BMP levels, lysosomal enzyme trafficking, and cell viability

  • Structure-based virtual screening:

    • Utilize AlphaFold2-predicted CLN8 structure for in silico compound docking

    • Prioritize compounds predicted to bind near the active site or disease mutation sites

  • Target validation:

    • Thermal shift assays to confirm direct compound binding to CLN8

    • Cellular target engagement studies

    • Medicinal chemistry optimization of hit compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.