Recombinant Human Protein CNPPD1 (CNPPD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNPPD1; C2orf24; CDABP0125; CGI-57; Protein CNPPD1; Cyclin Pas1/PHO80 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNPPD1
Target Protein Sequence
MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE IFEVLSWLESCVAEQQGRWRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV SSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEPCIPSVPQCLPSLANVSSCLE GSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCHACLHPNRTVP TALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG
Uniprot No.

Target Background

Database Links

HGNC: 25220

KEGG: hsa:27013

STRING: 9606.ENSP00000353698

UniGene: Hs.4973

Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CNPPD1 and what cellular functions is it predicted to perform?

CNPPD1 (Cyclin Pas1/PHO80 Domain Containing 1) is a protein-coding gene that demonstrates predicted functionality as a cyclin-dependent protein serine/threonine kinase regulator. According to functional annotations, CNPPD1 is predicted to enable protein kinase binding activities and to be involved in the regulation of cyclin-dependent protein serine/threonine kinase activities . The protein is predicted to be an integral component of membrane structures while also being active in the nucleus, suggesting potential multifunctional roles in cellular signaling. CNPPD1 is predicted to be part of cyclin-dependent protein kinase holoenzyme complexes, indicating a potential role in cell cycle regulation .

Methodologically, researchers investigating CNPPD1 function should consider:

  • Employing protein-protein interaction assays such as co-immunoprecipitation to confirm predicted binding partners

  • Utilizing subcellular fractionation techniques to verify the predicted nuclear and membrane localization

  • Implementing kinase activity assays to validate the predicted regulatory effects on CDK activity

What are the key domains and structural features of CNPPD1 protein?

Based on its name, CNPPD1 contains a Cyclin Pas1/PHO80 domain, which is associated with proteins involved in cell cycle regulation. While the specific tertiary structure of CNPPD1 has not been fully characterized in the provided data, researchers can apply various predictive approaches similar to those used for the analysis of other proteins.

For methodological structure prediction:

  • Employ molecular modeling via platforms such as SWISS-MODEL server to predict tertiary structure using homologous proteins as templates

  • Analyze transmembrane regions, potential antigenic sites, and epitopes using algorithms described by Kyte-Doolittle, Jameson-Wolf, and Kolaskar-Tongaonkar approaches

  • Assess surface probability using methods like those described by Emini et al.

  • Utilize sequence alignment comparison with related proteins to identify conserved regions that may indicate functional domains

Researchers should note that prediction accuracy depends on the quality of available templates and the degree of sequence similarity with structurally characterized proteins.

What expression systems are most effective for producing functional recombinant CNPPD1?

For recombinant CNPPD1 expression, researchers should consider multiple expression systems based on the intended experimental applications:

  • Bacterial Expression (E. coli):

    • Advantages: Rapid growth, high yield, cost-effective

    • Methodology: Clone the CNPPD1 ORF in-frame with expression vectors like pET-SUMO, similar to the approach used for recombinant nucleoprotein and matrix proteins

    • Considerations: May lack post-translational modifications; protein solubility may be challenging

  • Mammalian Expression Systems:

    • Advantages: Proper folding and post-translational modifications

    • Methodology: Transfect HEK293 or CHO cells with mammalian expression vectors containing CNPPD1

    • Considerations: Lower yields, higher cost, longer production time

  • Insect Cell Expression:

    • Advantages: Higher yields than mammalian cells with proper eukaryotic modifications

    • Methodology: Use baculovirus expression vectors for protein production in Sf9 or Hi5 cells

    • Considerations: Intermediate cost and complexity

Expression system selection should be guided by the research question—structural studies may tolerate bacterial expression, while functional analyses may require mammalian systems to ensure proper modification and folding.

What purification strategies optimize yield and activity of recombinant CNPPD1?

Developing an effective purification strategy for recombinant CNPPD1 requires consideration of the protein's predicted properties and experimental goals:

  • Affinity Chromatography:

    • Methodology: Express CNPPD1 with affinity tags (His6, GST, SUMO) for selective capture on appropriate resins

    • Implementation: Similar to the approach used for nucleoprotein and matrix protein purification , utilize SUMO-fusion strategy for enhanced solubility and native N-terminus after tag removal

  • Ion Exchange Chromatography:

    • Methodology: Based on the predicted isoelectric point of CNPPD1, select appropriate ion exchange media

    • Implementation: Use step or gradient elution to separate CNPPD1 from contaminants with different charge characteristics

  • Size Exclusion Chromatography:

    • Methodology: As a polishing step, separate monomeric CNPPD1 from aggregates and remaining contaminants

    • Implementation: Select appropriate column matrix based on the molecular weight of CNPPD1

A typical purification workflow would include:

  • Affinity capture of tagged CNPPD1

  • Tag removal (if necessary)

  • Secondary purification by ion exchange

  • Final polishing by size exclusion

  • Validation of purity by SDS-PAGE and functional assays

How can researchers assess the structural integrity and functionality of purified recombinant CNPPD1?

Comprehensive characterization of recombinant CNPPD1 requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy

    • Methodology: Analyze secondary structure composition (α-helices, β-sheets)

    • Data Interpretation: Compare with structural predictions or related proteins

  • Thermal Shift Assays

    • Methodology: Monitor protein unfolding using fluorescent dyes

    • Implementation: Identify buffer conditions that enhance stability

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)

    • Methodology: Determine oligomeric state and homogeneity

    • Data Analysis: Calculate absolute molecular weight and detect aggregation

Functional Characterization:

  • Kinase Regulation Assays

    • Methodology: Assess impact on cyclin-dependent kinase activity

    • Controls: Compare with known CDK regulators

  • Protein-Protein Interaction Analysis

    • Methodology: Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI)

    • Implementation: Quantify binding affinity to predicted interaction partners

  • Cell-Based Functional Assays

    • Methodology: Assess effects of recombinant CNPPD1 on cell cycle progression

    • Controls: Include both positive and negative controls

What analytical methods are recommended for determining purity and concentration of CNPPD1 preparations?

Accurate determination of purity and concentration is critical for reproducible experimentation:

Purity Assessment:

  • SDS-PAGE Analysis

    • Methodology: Evaluate sample homogeneity and detect contaminants

    • Implementation: Both Coomassie staining and silver staining for different sensitivity ranges

  • High-Performance Liquid Chromatography (HPLC)

    • Methodology: Reverse-phase or size exclusion HPLC for purity profile

    • Data Analysis: Calculate percent purity based on chromatogram peak areas

  • Mass Spectrometry

    • Methodology: Identify contaminants and confirm protein identity

    • Implementation: Both intact mass analysis and peptide mapping after digestion

Concentration Determination:

  • UV-Visible Spectroscopy

    • Methodology: Measure absorbance at 280 nm

    • Calculation: Use predicted extinction coefficient based on amino acid composition

  • Colorimetric Assays

    • Methodology: Bradford or BCA assays for total protein quantification

    • Considerations: Potential interference from buffer components

  • Amino Acid Analysis

    • Methodology: Quantitative determination of amino acid composition

    • Implementation: As a reference method for calibrating other quantification techniques

MethodDetection LimitAdvantagesLimitations
SDS-PAGE~100 ng/bandVisual assessment, simpleSemi-quantitative
HPLC~0.1% impuritiesHigh resolution, quantifiableRequires reference standards
Mass Spectrometry~0.1% impuritiesIdentity confirmation, high sensitivityComplex data interpretation
UV Spectroscopy~0.05 mg/mLRapid, non-destructiveAffected by nucleic acid contamination
Bradford Assay~1-20 μg/mLSimple, rapidProtein-dependent response
BCA Assay~0.5-20 μg/mLCompatible with detergentsAffected by reducing agents
Amino Acid Analysis~1 pmol/amino acidHighest accuracyTime-consuming, expensive

How can recombinant CNPPD1 be effectively used in protein-protein interaction studies?

Given CNPPD1's predicted role in cyclin-dependent protein kinase complexes, protein-protein interaction studies are critical for understanding its function:

In Vitro Interaction Studies:

  • Pull-down Assays

    • Methodology: Immobilize tagged CNPPD1 on appropriate resin, incubate with potential interacting proteins

    • Controls: Include negative controls with unrelated proteins and blocking conditions

  • Surface Plasmon Resonance (SPR)

    • Methodology: Immobilize CNPPD1 on sensor chip, measure real-time binding kinetics

    • Data Analysis: Calculate kon, koff, and KD values for quantitative comparison of binding partners

  • Isothermal Titration Calorimetry (ITC)

    • Methodology: Measure heat changes during binding to determine thermodynamic parameters

    • Implementation: Optimize protein and buffer conditions to maximize signal-to-noise ratio

Cellular Interaction Studies:

  • Co-immunoprecipitation

    • Methodology: Express tagged CNPPD1 in cells, immunoprecipitate complexes with anti-tag antibodies

    • Validation: Confirm interactions using reciprocal co-IP and Western blotting

  • Proximity Ligation Assay (PLA)

    • Methodology: Visualize protein interactions in fixed cells using antibody-oligonucleotide conjugates

    • Controls: Include antibody specificity controls and non-interacting protein pairs

  • Förster Resonance Energy Transfer (FRET)

    • Methodology: Express CNPPD1 and potential partners as fluorescent fusion proteins

    • Analysis: Measure energy transfer as evidence of close molecular proximity

What are the best approaches for investigating CNPPD1's role in cell cycle regulation?

Based on CNPPD1's predicted involvement in cyclin-dependent kinase regulation, the following methodologies are recommended:

Cell Cycle Analysis:

  • Flow Cytometry

    • Methodology: Analyze DNA content with propidium iodide staining in cells with modulated CNPPD1 expression

    • Controls: Compare with cells expressing known cell cycle regulators

  • Time-lapse Microscopy

    • Methodology: Monitor cell division timing in cells expressing fluorescently-tagged CNPPD1

    • Analysis: Quantify cell cycle phase durations under various conditions

  • CDK Activity Assays

    • Methodology: Measure cyclin-dependent kinase activity in the presence/absence of CNPPD1

    • Implementation: Use phospho-specific antibodies or kinase activity kits

Gene Perturbation Studies:

  • CRISPR/Cas9 Genome Editing

    • Methodology: Generate CNPPD1 knockout cell lines and analyze cell cycle phenotypes

    • Validation: Rescue experiments with recombinant CNPPD1

  • Inducible Expression Systems

    • Methodology: Create stable cell lines with tetracycline-inducible CNPPD1 expression

    • Analysis: Monitor cell cycle progression at different expression levels

  • Transcriptome Analysis

    • Methodology: Compare gene expression profiles in cells with varied CNPPD1 levels

    • Data Interpretation: Identify enriched pathways using tools like GSEA

How can researchers investigate the role of post-translational modifications in CNPPD1 function?

Post-translational modifications (PTMs) can significantly impact protein function, localization, and interactions. To investigate PTMs in CNPPD1:

Identification of PTMs:

  • Mass Spectrometry Analysis

    • Methodology: Analyze enriched CNPPD1 from cellular extracts using LC-MS/MS

    • Implementation: Compare PTM profiles across different cell types and conditions

  • PTM-specific Antibodies

    • Methodology: Develop or acquire antibodies against predicted PTM sites

    • Validation: Confirm specificity using mutated control proteins

  • Computational Prediction

    • Methodology: Use algorithms to predict potential phosphorylation, acetylation, or ubiquitination sites

    • Verification: Experimentally validate high-confidence predictions

Functional Impact Assessment:

  • Site-directed Mutagenesis

    • Methodology: Generate CNPPD1 variants with mutated PTM sites (phospho-mimetic or non-modifiable)

    • Analysis: Compare functional properties of WT and mutant proteins

  • In Vitro Enzymatic Modification

    • Methodology: Treat recombinant CNPPD1 with kinases, acetylases, or other modifying enzymes

    • Assessment: Compare functional properties before and after modification

  • Temporal Dynamics

    • Methodology: Monitor PTM changes during cell cycle progression

    • Implementation: Synchronize cells and analyze CNPPD1 PTMs at defined time points

What approaches can identify the transcriptional networks affected by CNPPD1?

Understanding the broader impact of CNPPD1 on gene regulation networks requires comprehensive approaches:

Gene Expression Analysis:

  • RNA-Seq

    • Methodology: Compare transcriptomes in control vs. CNPPD1-modulated cells

    • Implementation: Similar to large-scale gene perturbation experiments described for yeast

    • Analysis: Identify differentially expressed genes and enriched pathways

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq)

    • Methodology: If CNPPD1 associates with chromatin, identify genomic binding sites

    • Controls: Include input DNA and IgG controls for specificity

  • Proteomics

    • Methodology: Quantitative proteomics to identify proteins affected by CNPPD1 modulation

    • Implementation: SILAC or TMT labeling for accurate quantification

Network Analysis:

  • Coarse Network Structure Estimation

    • Methodology: Based on perturbation data, estimate regulatory network features

    • Implementation: Apply numerical estimation approaches similar to those used for yeast networks

    • Analysis: Determine network sparsity and identify independent subnetworks

  • Pathway Enrichment

    • Methodology: Determine which cellular pathways are overrepresented in affected genes

    • Tools: Gene Ontology, KEGG, Reactome analyses

  • Integration with Public Datasets

    • Methodology: Compare CNPPD1-regulated genes with datasets from related conditions

    • Implementation: Use meta-analysis approaches to identify core regulatory modules

What methodologies are appropriate for investigating CNPPD1's potential role in disease pathways?

While specific disease associations for CNPPD1 are not well-established in the provided information, its predicted role in cell cycle regulation suggests potential disease relevance:

Disease Association Analysis:

  • Genomic Studies

    • Methodology: Analyze GWAS data for CNPPD1 locus associations with disease

    • Implementation: Integrate with functional genomics data to establish causality

  • Expression Analysis in Disease Samples

    • Methodology: Compare CNPPD1 expression levels between normal and disease tissues

    • Implementation: Use immunohistochemistry and qRT-PCR for validation

  • Patient-derived Cell Models

    • Methodology: Study CNPPD1 function in cells derived from patients with relevant disorders

    • Controls: Include matched healthy donor cells

Functional Validation:

  • Disease Model Systems

    • Methodology: Manipulate CNPPD1 expression in appropriate disease models

    • Assessment: Evaluate impact on disease-relevant phenotypes

  • Mechanistic Studies

    • Methodology: Investigate how CNPPD1 variants affect protein function and pathway regulation

    • Implementation: Compare wild-type and variant proteins in functional assays

  • Therapeutic Target Validation

    • Methodology: Assess whether modulation of CNPPD1 function affects disease outcomes

    • Approaches: Use both gain-of-function and loss-of-function strategies

How can researchers develop specific antibodies or detection methods for CNPPD1?

Development of specific detection reagents is crucial for advancing CNPPD1 research:

Antibody Development:

  • Epitope Selection

    • Methodology: Identify antigenic regions unique to CNPPD1 using bioinformatic predictions

    • Implementation: Apply algorithms such as those described by Kolaskar and Tongaonkar

  • Immunization Strategies

    • Methodology: Generate antibodies using recombinant protein, peptides, or DNA immunization

    • Validation: Test specificity against recombinant protein and cellular extracts

  • Monoclonal vs. Polyclonal Considerations

    • Methodology: Develop monoclonals for specific epitopes or polyclonals for broader detection

    • Implementation: Screen hybridomas or purify polyclonal antibodies for optimal specificity

Alternative Detection Methods:

  • Proximity Ligation Assays

    • Methodology: Develop PLA protocols using available antibodies

    • Advantage: Higher specificity through dual antibody recognition

  • Mass Spectrometry-based Detection

    • Methodology: Develop targeted MS methods (MRM/PRM) for CNPPD1 peptides

    • Implementation: Select unique peptides with good ionization properties

  • Aptamer Development

    • Methodology: Select RNA or DNA aptamers against purified CNPPD1

    • Advantage: Can be developed without animal immunization

Detection MethodSensitivitySpecificityApplication RangeDevelopment Time
Monoclonal AntibodiesHighVery HighWide4-6 months
Polyclonal AntibodiesHighModerateWide2-3 months
Targeted MS (MRM/PRM)Moderate-HighVery HighLimited1-2 months
Proximity LigationVery HighHighLimited1-2 months
AptamersModerate-HighHighModerate2-3 months

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.