Recombinant Human Protein cornichon homolog 2 (CNIH2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNIH2; CNIL; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; Cornichon-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNIH2
Target Protein Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Uniprot No.

Target Background

Function
Recombinant Human Cornichon Homolog 2 (CNIH2) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their membrane and synaptic targeting, modulating gating properties by influencing activation, deactivation, and desensitization rates. Furthermore, CNIH2 blocks CACNG8-mediated AMPA receptor resensitization.
Gene References Into Functions
  1. Elevated CNIH-2 mRNA expression has been significantly associated with schizophrenia. PMID: 23103966
Database Links

HGNC: 28744

OMIM: 611288

KEGG: hsa:254263

STRING: 9606.ENSP00000310003

UniGene: Hs.437072

Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine. Cell junction, synapse, postsynaptic density.
Tissue Specificity
Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study).

Q&A

What is cornichon homolog 2 (CNIH2) and what is its primary function?

Cornichon homolog 2 (CNIH2) is a transmembrane protein that was identified by proteomic analysis as an AMPA receptor (AMPAR)-interacting protein. It is part of the cornichon family of proteins, with CNIH-2 and CNIH-3 (but not CNIH-1) being functionally important for AMPAR regulation . The primary function of CNIH2 is to modify AMPAR properties by:

  • Slowing the deactivation and desensitization kinetics of AMPARs

  • Enhancing glutamate sensitivity of calcium-permeable AMPARs

  • Increasing single-channel conductance of AMPARs

  • Modifying calcium permeability of AMPARs

  • Decreasing intracellular polyamine block of AMPARs

These modifications significantly alter the functional properties of AMPARs, which are responsible for the majority of excitatory synaptic transmission in the central nervous system .

How does CNIH2 differ from other cornichon family members?

Within the cornichon family, CNIH-2 and CNIH-3 have been found to modify AMPAR properties, while CNIH-1 does not show the same effects. Specifically:

  • CNIH-2 and CNIH-3 slow deactivation and desensitization of both GluA2-containing calcium-impermeable AMPARs and GluA2-lacking calcium-permeable AMPARs

  • CNIH-1 does not produce these effects on AMPAR kinetics

  • CNIH-2 and CNIH-3 enhance glutamate sensitivity, single-channel conductance, and calcium permeability of calcium-permeable AMPARs

  • CNIH-2 and CNIH-3 decrease intracellular polyamine block in calcium-permeable AMPARs

These functional differences highlight the specific roles of CNIH-2 and CNIH-3 in modulating AMPAR function in neurons and glial cells, including oligodendrocyte precursor cells (OPCs) .

What is the evidence that CNIH2 is expressed at the cell surface and incorporated into functional AMPARs?

Multiple lines of evidence demonstrate that CNIH2 is expressed at the cell surface and incorporated into functional AMPARs:

  • Surface immunolabeling: Studies have shown surface immunolabeling of oligodendrocyte precursor cells (OPCs) with antibodies to CNIH-2/3, confirming the presence of cornichon proteins in the cell membrane .

  • Electrophysiological evidence: Whole-cell recordings from OPCs showed response patterns consistent with the incorporation of CNIHs in functional surface AMPARs, including:

    • Characteristic relative amplitude ratios of responses to glutamate versus kainate

    • Marked potentiation of kainate responses by cyclothiazide (CTZ), a positive allosteric modulator

  • Immunofluorescence microscopy: While the majority of CNIH-2 is intracellular, newer antibodies have detected CNIH-2 on the cell surface .

  • Functional effects: CNIH-2 overexpression in OPCs markedly slowed AMPAR desensitization, which would only be possible if CNIH-2 was incorporated into surface receptors .

  • Rescue experiments: Transfection of CNIH-2 into neurons from CNIH-2 knockout mice fully rescued AMPAR-mediated excitatory postsynaptic currents (EPSCs), indicating functional incorporation into surface receptors .

How does CNIH2 deletion specifically affect different AMPAR subunit combinations?

CNIH2 deletion has remarkably selective effects on different AMPAR subunit combinations, with striking specificity for GluA1-containing receptors:

  • GluA1-specific effects: CNIH-2 deletion in neurons leads to a profound reduction in GluA1-containing AMPAR synaptic transmission. This effect is subunit-specific, as knockdown of CNIH-2 in neurons from GluA1 knockout mice had no effect on AMPAR-eEPSCs .

  • GluA2A3 heteromers: In the absence of CNIH-2, a small residual pool of synaptic GluA2A3 heteromers remains, which exhibit faster kinetics than the predominant GluA1A2 heteromers normally present .

  • Quantitative impact: CNIH-2 deletion in CA1 pyramidal neurons causes approximately a 54% reduction in AMPAR-mediated excitatory postsynaptic currents (AMPAR-eEPSCs) with no change in NMDAR-eEPSCs, demonstrating a selective effect on AMPAR-mediated transmission .

  • Cellular specificity: Similar reductions in AMPAR/NMDAR ratios were observed in dentate granule neurons and layer 2/3 pyramidal neurons in barrel cortex following CNIH-2 deletion, indicating this is a widespread mechanism .

This selective regulation of GluA1-containing AMPARs by CNIH-2 appears to be mediated through an interplay with TARP γ-8, which prevents functional association of CNIHs with non-GluA1 subunits .

What is the molecular mechanism behind CNIH2's differential effects on AMPAR subunits?

The molecular mechanism behind CNIH2's differential effects on AMPAR subunits involves complex interactions with transmembrane AMPAR regulatory proteins (TARPs), particularly γ-8:

This sophisticated interplay between CNIHs and γ-8 creates a subunit-specific regulatory mechanism that dictates AMPAR trafficking and the resulting kinetics of synaptic transmission.

How does CNIH2 affect AMPAR trafficking through the secretory pathway?

CNIH2 plays a crucial role in AMPAR trafficking through the secretory pathway, particularly for GluA1-containing receptors:

  • Glycosylation effects: Analysis of receptor glycosylation using endoglycosidase H (Endo H) demonstrated that both GluA1 and GluA2 showed increased sensitivity to Endo H in CNIH-2 knockout brains. This was evidenced by stronger Endo H-sensitive immature bands compared to Endo H-resistant mature bands .

  • ER/Golgi retention: The increased Endo H-sensitive fraction suggests that a large pool of immature receptors are retained in the endoplasmic reticulum (ER) or cis-Golgi in the absence of CNIH-2 .

  • Surface delivery: Immunofluorescence studies in dissociated rat hippocampal neurons showed that CNIH-2 knockdown dramatically reduced surface GluA1, consistent with findings showing reduction of synaptic currents .

  • Total vs. surface expression: Despite the profound reduction in surface GluA1, total GluA1 and GluA2 expression levels were only modestly reduced (approximately 15%) in CNIH-2 knockout mice, indicating that the primary effect is on trafficking rather than protein synthesis or stability .

This trafficking role of CNIH-2 is distinct from but complementary to its effects on channel properties, suggesting multiple functions in AMPAR regulation.

What experimental approaches are used to study CNIH2 function in recombinant systems?

Several robust experimental approaches have been established to study CNIH2 function in recombinant systems:

  • Heterologous expression systems: tsA201 cells and HEK cells are commonly used to express various combinations of AMPAR subunits with CNIH-2 and TARPs to study their interactions .

  • Electrophysiological techniques:

    • Ultra-fast glutamate application to outside-out patches to measure AMPAR deactivation and desensitization kinetics

    • Whole-cell recordings to measure current amplitudes and rectification properties

    • Analysis of kainate/glutamate response ratios to assess TARP stoichiometry

  • Subunit composition analysis:

    • Co-expression of GluA1, GluA2, GluA3 with CNIH-2 and/or γ-8

    • Use of unedited GluA2(Q) versus edited GluA2(R) to study functional differences

    • Creation of GluA1A2 heteromers to mimic native receptors

  • Protein biochemistry:

    • Co-immunoprecipitation to detect protein-protein interactions

    • Western blotting to quantify expression levels

    • Glycosylation analysis using endoglycosidase H (Endo H) and PNGase F to assess receptor maturation

These techniques allow for detailed characterization of how CNIH-2 modifies AMPAR properties and interacts with other regulatory proteins in controlled recombinant systems.

What genetic tools and mouse models are available for studying CNIH2 in vivo?

Several sophisticated genetic tools and mouse models have been developed for studying CNIH2 function in vivo:

  • Conditional knockout models:

    • Cnih2 fl/fl mice: Allow for spatial and temporal control of CNIH-2 deletion

    • NEX-CRE × Cnih2 fl/fl mouse line (Nex Cnih2-/-): Enables forebrain-specific deletion of CNIH-2

  • Viral and transfection approaches:

    • AAV-CRE-GFP injection into the hippocampus of Cnih2 fl/fl mouse pups

    • Biolistic transfection of hippocampal slice cultures from Cnih2 fl/fl mice with CRE-GFP

  • RNA interference tools:

    • CNIH-2 shRNA for acute knockdown of CNIH-2 expression

    • Scrambled shRNA controls to verify specificity

  • Subunit-specific knockout combinations:

    • CNIH-2 manipulation in GluA1 knockout mice

    • CNIH-2 manipulation in GluA2 knockout mice

    • Allows for isolation of subunit-specific effects

  • Rescue experiments:

    • CNIH-2 transfection into CNIH-2 knockout neurons for functional rescue

    • Tests sufficiency of CNIH-2 for restoring normal AMPAR function

These genetic tools provide a powerful platform for dissecting the roles of CNIH-2 in specific neuronal populations, circuits, and developmental periods.

What electrophysiological protocols best characterize CNIH2's effects on AMPAR kinetics?

Specific electrophysiological protocols have been optimized to characterize CNIH2's effects on AMPAR kinetics with high precision:

  • Ultra-fast glutamate application to outside-out patches:

    • Allows measurement of receptor deactivation (τ-deactivation) following brief (1-2 ms) applications of saturating glutamate (10 mM)

    • Enables assessment of receptor desensitization (τ-desensitization) during sustained glutamate application

    • Reveals CNIH-2's approximately twofold slowing effect on AMPAR desensitization and deactivation

  • Synaptic current analysis:

    • Evoked EPSC (eEPSC) decay kinetics measurement

    • Miniature EPSC (mEPSC) amplitude and decay analysis

    • Paired-pulse ratio assessment to confirm postsynaptic mechanisms

  • Pharmacological manipulations:

    • Application of cyclothiazide (CTZ) to block desensitization

    • Use of kainate as a partial agonist to assess TARP stoichiometry (IKA/IGlu ratio)

    • Rectification analysis with intracellular polyamines to assess calcium permeability

  • Extrasynaptic AMPAR analysis:

    • Somatic outside-out patches in the presence of cyclothiazide

    • Assessment of extrasynaptic current amplitudes compared to synaptic currents

These protocols provide complementary information about how CNIH-2 modulates various aspects of AMPAR function, from channel gating to synaptic integration.

How can researchers distinguish between CNIH2's effects on AMPAR trafficking versus direct modulation of channel properties?

Distinguishing between CNIH2's effects on AMPAR trafficking versus direct channel modulation requires specific experimental strategies:

  • Surface expression versus total expression analysis:

    • Surface biotinylation assays to quantify surface receptor levels

    • Immunofluorescence microscopy to visualize surface versus intracellular receptors

    • Comparison of total protein levels by Western blotting with surface expression

  • Glycosylation state analysis:

    • Endoglycosidase H (Endo H) sensitivity to identify immature receptors retained in ER/Golgi

    • PNGase F treatment to remove all N-linked carbohydrates as a control

    • Quantification of mature versus immature receptor ratios

  • Acute versus chronic manipulations:

    • Acute application of purified CNIH-2 protein to outside-out patches

    • Chronic genetic deletion or knockdown approaches

    • Comparison of effects to separate trafficking from direct modulation

  • Subunit-selective approach:

    • Comparison of CNIH-2 effects on different AMPAR subunit combinations

    • Assessment in subunit knockout backgrounds (e.g., GluA1 KO, GluA2 KO)

    • Analysis of remaining receptor pools after CNIH-2 deletion

  • Correlation analysis:

    • Relating CNIH-2-dependent kinetic changes to changes in receptor abundance

    • Statistical analysis to determine if effects can be explained by trafficking alone

Using these approaches in combination provides a comprehensive understanding of CNIH-2's dual roles in AMPAR regulation.

How might CNIH2 dysfunction contribute to neurological disorders?

Given CNIH2's profound impact on excitatory synaptic transmission, its dysfunction could contribute to several neurological disorders:

  • Epilepsy and seizure disorders:

    • CNIH2 regulates AMPAR kinetics and calcium permeability

    • Alterations could disrupt excitation/inhibition balance

    • The specific effect on GluA1-containing AMPARs might affect circuit excitability

  • Neurodevelopmental disorders:

    • CNIH2's role in AMPAR trafficking during development

    • Potential impact on synapse formation and maturation

    • Subunit-specific regulation might influence critical periods

  • Learning and memory disorders:

    • GluA1-containing AMPARs are critical for hippocampal synaptic plasticity

    • CNIH2 modification of AMPAR kinetics affects temporal integration

    • Selective loss of GluA1A2 heteromers would impair specific forms of memory

  • Neurodegenerative conditions:

    • Altered glutamate receptor function is implicated in excitotoxicity

    • CNIH2 regulation of calcium permeability could affect vulnerability

    • ER/Golgi trafficking defects might contribute to proteostatic stress

Research connecting CNIH2 variations to specific disorders is still emerging, but the fundamental regulatory mechanisms suggest multiple potential pathological pathways.

What are the promising directions for developing CNIH2-targeted therapeutic approaches?

Several promising directions exist for developing CNIH2-targeted therapeutic approaches:

  • Subunit-selective modulation:

    • CNIH2's selective effect on GluA1-containing AMPARs offers potential for targeted intervention

    • Compounds that modulate CNIH2-AMPAR interactions could affect specific circuits

    • This approach might avoid side effects associated with broad AMPAR antagonists

  • Trafficking enhancement:

    • Molecules that enhance CNIH2-mediated trafficking might rescue synaptic deficits

    • Particularly relevant for conditions with reduced surface AMPAR expression

    • Could potentially enhance cognitive function in specific disorders

  • Kinetic modulation:

    • CNIH2's effects on AMPAR kinetics could be targeted to adjust synaptic integration

    • Slowing or accelerating AMPAR kinetics has different functional consequences

    • Tailored approaches could address specific circuit dysfunctions

  • Regulatory pathway targeting:

    • Interventions targeting the interplay between CNIH2 and TARP γ-8

    • Modification of the stoichiometry of auxiliary proteins in the AMPAR complex

    • Potential for fine-tuning receptor properties rather than all-or-none modulation

These approaches would require detailed understanding of CNIH2 structure-function relationships and development of selective pharmacological tools or gene therapy approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.