Recombinant Human Protein cornichon homolog 3 (CNIH3)

Shipped with Ice Packs
In Stock
Cat. No.
BT2488615
Source
in vitro E.coli expression system
Synonyms
CNIH3; Protein cornichon homolog 3; CNIH-3; Cornichon family AMPA receptor auxiliary protein 3
Quick Inquiry

Description

Introduction to Recombinant Human Protein Cornichon Homolog 3 (CNIH3)

Recombinant Human Protein cornichon homolog 3 (CNIH3) is a protein that belongs to the cornichon family, which plays a crucial role in modulating AMPA receptors. AMPA receptors are key components in excitatory neurotransmission within the central nervous system. CNIH3, as an auxiliary protein, influences the trafficking, localization, and function of AMPA receptors, thereby affecting synaptic plasticity and neuronal excitability.

Function and Role of CNIH3

CNIH3 is involved in the regulation of AMPA receptor-mediated synaptic transmission. By modulating the surface expression and synaptic localization of AMPA receptors, CNIH3 can influence learning and memory processes. Additionally, research suggests that CNIH3 may be implicated in the pathophysiology of opioid dependence, highlighting its potential role in neurological disorders .

Recombinant CNIH3 Protein Preparation and Suppliers

Recombinant Human Protein CNIH3 is available from several suppliers, including CUSABIO TECHNOLOGY LLC, which offers a range of recombinant proteins for research purposes . The preparation of recombinant CNIH3 typically involves expression in host cells such as bacteria or mammalian cell lines, followed by purification and characterization.

Future Directions and Potential Applications

Future research on CNIH3 could focus on elucidating its precise mechanisms of action and exploring its potential as a therapeutic target for neurological disorders. Given its involvement in opioid dependence, CNIH3 may offer insights into developing novel treatments for addiction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNIH3; Protein cornichon homolog 3; CNIH-3; Cornichon family AMPA receptor auxiliary protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNIH3
Target Protein Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Uniprot No.
Q8TBE1

Target Background

Function
Recombinant Human Cornichon Homolog 3 (CNIH3) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It promotes their delivery to the cell membrane and synapses, modulating their gating kinetics by influencing activation, deactivation, and desensitization rates.
Gene References Into Functions
  1. Convergent findings in human and mouse studies support CNIH3's role in the pathophysiology of opioid dependence, complementing research implicating the AMPA glutamate system. PMID: 26239289
  2. Significant upregulation of CNIH-3 mRNA expression has been observed in schizophrenia. PMID: 23103966
Database Links

HGNC: 26802

KEGG: hsa:149111

STRING: 9606.ENSP00000272133

UniGene: Hs.731723

Protein Families
Cornichon family
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.