Recombinant Human Protein cornichon homolog 4 (CNIH4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and agreed upon in advance, incurring an additional fee.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNIH4; HSPC163; Protein cornichon homolog 4; CNIH-4; Cornichon family AMPA receptor auxiliary protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CNIH4
Target Protein Sequence
MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTV LLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGF HLLCFFMYLYSMILALIND
Uniprot No.

Target Background

Function
Cornichon homolog 4 (CNIH4) is involved in the trafficking of G protein-coupled receptors (GPCRs) from the endoplasmic reticulum to the cell surface. It facilitates GPCR exit from the early secretory pathway, potentially through interactions with the COPII machinery.
Gene References Into Functions
  1. The circular RNA hsa_circ_0000190 (gene symbol CNIH4) has been identified as a potential non-invasive biomarker for gastric cancer diagnosis. PMID: 28130019
Database Links

HGNC: 25013

OMIM: 617483

KEGG: hsa:29097

STRING: 9606.ENSP00000420443

UniGene: Hs.445890

Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment.

Q&A

What is CNIH4 and what is its primary biological function?

CNIH4 (Cornichon family AMPA receptor auxiliary protein 4) is a transmembrane protein that plays a crucial role in vesicle trafficking, particularly in the early secretory pathway. Research has established that CNIH4 is primarily involved in G protein-coupled receptors (GPCRs) trafficking from the endoplasmic reticulum to the cell surface, promoting the exit of GPCRs through interaction with the COPII machinery . CNIH4 belongs to the cornichon family of proteins and functions as an essential component in the regulation of protein transport and secretion. In recent studies, CNIH4 has been implicated in various pathological processes, particularly in cancer development and progression .

What are the standard methods for detecting CNIH4 expression in tissue samples?

Several validated techniques are available for CNIH4 detection in research settings:

  • Immunohistochemistry (IHC): Commercial antibodies such as rabbit polyclonal CNIH4 antibodies have been validated for IHC-P (paraffin-embedded tissues) with typical dilutions around 1/200 . For optimal results, antigen retrieval followed by overnight incubation at 4°C is recommended.

  • Western Blotting: For protein expression analysis, researchers typically use antibodies targeting recombinant fragment proteins within Human CNIH4.

  • RT-qPCR: For mRNA expression analysis, studies commonly use TCGA and GTEx mRNA expression profiles to establish baseline expression levels across tissues .

  • RNA-Sequencing: This approach provides comprehensive transcriptomic analysis and has been used in multiple studies to evaluate CNIH4 expression patterns across cancer types .

The selection of method should be based on specific research questions, with consideration for tissue availability and requirement for quantitative versus qualitative data.

How is CNIH4 expression regulated in normal versus pathological conditions?

Regulatory mechanisms include:

  • Epigenetic Regulation: Methylation analysis reveals correlation between methylation status and CNIH4 mRNA expression across cancer types .

  • Alternative Splicing: Clinical alternative splicing events affect CNIH4 expression, as identified through the ClinicalAS module analysis .

  • Genomic Alterations: CNV (Copy Number Variation) contributes to CNIH4 expression variations, with amplifications observed in multiple cancer types .

The transition from normal to pathological expression appears to involve multiple regulatory layers, making CNIH4 a complex target for therapeutic intervention.

What is the significance of CNIH4 as a potential cancer biomarker?

CNIH4 has emerged as a promising biomarker across multiple cancer types, with particular significance in prognostic evaluation:

  • Prognostic Value: Higher CNIH4 expression consistently correlates with poor outcomes in multiple cancers. In cervical cancer, elevated CNIH4 levels are associated with advanced tumor and pathological stages, as well as lymph node metastasis . Similar correlations have been observed in glioma and breast cancer .

  • Diagnostic Accuracy: ROC analysis demonstrates significant discriminatory power of CNIH4 expression between tumor and normal tissues, making it a potential diagnostic marker .

  • Predictive Modeling: A four-gene risk prediction signature utilizing CNIH4-related immunomodulators has shown potential as an auxiliary to TNM staging in cervical cancer .

  • Multivariate Predictive Value: CNIH4 maintains independent prognostic significance even after adjusting for traditional clinicopathological factors, as confirmed through multivariate Cox proportional hazard regression analyses .

For optimal implementation as a biomarker, researchers should consider combining CNIH4 expression with other established markers and clinical parameters in nomogram models to enhance predictive accuracy.

How does CNIH4 influence tumor immunity and the cancer microenvironment?

CNIH4 demonstrates significant associations with immune landscape characteristics across cancer types:

  • Immune Cell Infiltration: CNIH4 expression positively correlates with infiltration of specific immune cell populations, notably macrophages M2 and resting dendritic cells in cervical cancer . This suggests CNIH4 may influence immune surveillance and response.

  • Immune Pathway Modulation: Single-sample gene set enrichment analysis has revealed several immune pathways elevated in cancer samples with enhanced CNIH4 levels, including Type-I and Type-II IFN-response pathways .

  • Immune Subtypes Association: Pan-cancer analysis demonstrates CNIH4 expression correlates with specific immune subtypes, indicating potential involvement in shaping the immune contexture of tumors .

  • Immunotherapy Response Prediction: In glioma, the CNIH4-enriched subgroup shows negative modulation of immunotherapeutic response, suggesting CNIH4 expression may predict immunotherapy resistance .

Researchers investigating CNIH4 and immunity should employ multiplex immunofluorescence or single-cell RNA sequencing to further characterize the spatial relationship between CNIH4-expressing cells and immune populations within the tumor microenvironment.

What molecular mechanisms underlie CNIH4's role in cancer progression?

CNIH4 contributes to cancer progression through several interconnected molecular pathways:

  • Cell Cycle Regulation: CNIH4 is prominently associated with cell cycle pathways, with knockdown experiments demonstrating significant impacts on cell proliferation and cell cycle progression in breast cancer cell lines (MDA-MB-231) .

  • PI3K-Akt Signaling: Functional enrichment analysis of RNA-sequencing data from CNIH4-knocked down cervical cancer cell lines reveals strong association with the PI3K-Akt signaling pathway .

  • Stem Cell Maintenance: In glioma, CNIH4 regulates stem cell-like properties, with silencing experiments suppressing stemness in vitro and inhibiting tumorigenicity in vivo .

  • Genomic Instability: Pan-cancer analysis indicates CNIH4 upregulation significantly correlates with genomic instability markers and DNA repair pathways .

  • Drug Sensitivity Modulation: CNIH4 influences responsiveness to various kinase inhibitors and chemotherapeutic agents, suggesting involvement in drug resistance mechanisms .

Researchers should consider pathway-specific inhibitors in combination with CNIH4 modulation to comprehensively evaluate these mechanisms and identify potential synergistic therapeutic approaches.

What are the optimal protocols for CNIH4 knockdown or overexpression studies?

When designing CNIH4 modulation experiments, consider these evidence-based recommendations:

  • siRNA Transfection: Small interfering RNA (siRNA) has been successfully employed for CNIH4 knockdown in multiple cancer cell lines . Typical protocols use lipofectamine-based transfection with 50-100 nM siRNA concentration and validation of knockdown efficiency at 48-72 hours post-transfection.

  • shRNA Lentiviral Systems: For stable knockdown, lentiviral-based shRNA provides more consistent suppression. Optimized MOI (multiplicity of infection) ranges from 10-20 for most cancer cell lines, with puromycin selection (typically 2-5 µg/ml) for 7-10 days.

  • CRISPR-Cas9 Editing: For complete knockout studies, sgRNAs targeting early exons of CNIH4 yield most effective results. Multiple guide RNAs should be designed and tested for editing efficiency.

  • Overexpression Systems: For gain-of-function studies, mammalian expression vectors (typically pcDNA3.1 or pLVX) containing the full-length human CNIH4 cDNA with appropriate tags (e.g., FLAG, HA) facilitate detection and immunoprecipitation.

  • Controls: Essential controls include scrambled siRNA/shRNA, empty vector transfections, and wild-type cells. When possible, rescue experiments should be performed to confirm specificity of observed phenotypes.

The selection of modulation approach should align with experimental duration, required stability of modification, and downstream applications.

What functional assays are most informative for studying CNIH4's biological effects?

Based on CNIH4's established functions, these assays provide meaningful insights:

  • Proliferation Assays:

    • CCK-8 or MTT assays at 24, 48, 72, and 96 hours post-CNIH4 modulation

    • Colony formation assays (10-14 days) for long-term proliferative capacity

    • EdU incorporation for S-phase quantification

  • Cell Cycle Analysis:

    • Flow cytometry with propidium iodide staining

    • Western blotting for cyclins and CDK inhibitors

    • Analysis of G1/S and G2/M checkpoint proteins

  • Migration and Invasion:

    • Transwell assays (24-48 hours) with or without Matrigel

    • Wound healing assays with time-lapse imaging

    • 3D spheroid invasion assays for more physiological assessment

  • Vesicle Trafficking Assays:

    • GPCR surface expression quantification

    • ER-to-Golgi transport assays using fluorescent reporters

    • Co-immunoprecipitation with COPII components

  • In vivo Models:

    • Subcutaneous xenograft models to assess tumorigenicity

    • Orthotopic models for tissue-specific effects

    • Patient-derived xenografts for translational relevance

The combination of in vitro and in vivo assays provides comprehensive characterization of CNIH4's biological effects, with selection based on the specific research hypothesis being tested.

What considerations are important when developing or testing CNIH4-targeted therapeutics?

Development of CNIH4-targeted approaches should incorporate these research-informed strategies:

  • Target Validation:

    • Confirm differential expression between normal and malignant tissues across multiple datasets

    • Validate functional significance through loss-of-function and gain-of-function studies

    • Identify specific cancer types with strongest dependence on CNIH4 expression

  • Therapeutic Approaches:

    • Small molecule inhibitors targeting CNIH4-COPII interaction domains

    • Antisense oligonucleotides or siRNA-based therapeutics for expression modulation

    • Antibody-drug conjugates if cell-surface expression is confirmed

  • Efficacy Assessment:

    • Combination testing with standard-of-care treatments (e.g., temozolomide for glioma)

    • Evaluation in patient-derived organoids or xenografts

    • Assessment of effects on chemotherapy sensitivity, as CNIH4 influences drug response

  • Biomarker Development:

    • Validation of companion diagnostics to identify patients likely to respond

    • Implementation of the four-gene risk prediction signature for patient stratification

    • Integration with existing clinical parameters in predictive nomograms

  • Potential Limitations:

    • Assessment of on-target effects in normal tissues expressing CNIH4

    • Evaluation of potential for acquired resistance mechanisms

    • Consideration of alternative trafficking pathways that might compensate for CNIH4 inhibition

The combination of strong target validation and strategic therapeutic development increases the likelihood of successful translation to clinical applications.

How should researchers interpret CNIH4 expression data across different experimental platforms?

Integrating CNIH4 expression data from diverse platforms requires careful consideration:

  • RNA vs. Protein Correlation:

    • Transcriptional data may not perfectly correlate with protein expression

    • Verification of findings at both mRNA (qRT-PCR, RNA-seq) and protein (Western blot, IHC) levels is recommended

    • Alternative splicing events should be considered when interpreting mRNA data

  • Platform Normalization:

    • For microarray data, robust multi-array average (RMA) normalization

    • For RNA-seq, FPKM or TPM values with appropriate batch correction

    • For IHC, standardized H-scores or automated digital pathology quantification

  • Reference Standards:

    • Use of appropriate housekeeping genes (GAPDH, β-actin) for qRT-PCR

    • Inclusion of reference cell lines with known CNIH4 expression levels

    • Application of tissue-specific normal controls rather than universal standards

  • Cut-off Determination:

    • Optimal cut-off values for high vs. low expression should be determined using statistical methods such as those in the survminer package

    • Quartile-based stratification (Q1-Q4) provides nuanced evaluation of expression impacts

    • Restricted cubic spline (RCS) method helps identify non-linear effects of expression on outcomes

  • Integration Approaches:

    • Meta-analysis techniques for combining data from multiple sources

    • Machine learning algorithms for pattern recognition across heterogeneous datasets

    • Bayesian methods for inferring causal relationships between CNIH4 and phenotypes

Researchers should clearly report all normalization methods, cut-off determinations, and integration strategies to ensure reproducibility.

What bioinformatic pipelines are recommended for analyzing CNIH4 in multi-omics cancer datasets?

For comprehensive analysis of CNIH4 across multi-omics datasets, these validated approaches are recommended:

  • Expression Analysis:

    • Differential expression analysis between tumor/normal samples using DESeq2 or limma

    • Pan-cancer analysis across TCGA datasets using consistent normalization methods

    • Correlation with clinical parameters using appropriate statistical tests (chi-square, t-test)

  • Genomic Alterations:

    • CNV analysis using GISTIC2.0 algorithm

    • Mutation analysis through cBioPortal (http://www.cbioportal.org/)[4]

    • Structural variant identification through specialized pipelines (e.g., Manta, LUMPY)

  • Epigenetic Regulation:

    • Methylation analysis using beta values from platforms like Illumina 450K

    • Correlation between methylation status and expression levels

    • Identification of key regulatory regions through ATAC-seq or ChIP-seq

  • Functional Interpretation:

    • Pathway enrichment using Gene Set Enrichment Analysis (GSEA)

    • Protein-protein interaction networks through STRING or BioGRID

    • Single-sample GSEA (ssGSEA) for immune pathway activation assessment

  • Clinical Correlation:

    • Survival analysis using Kaplan-Meier and Cox regression models

    • ROC curve analysis for diagnostic potential evaluation

    • Nomogram construction using the "rms" package for integrated prognostic models

  • Advanced Integration:

    • eQTL-GWAS co-localization analysis using Bayesian approaches

    • Multi-omics factor analysis (MOFA) for dimension reduction

    • Single-cell and spatial transcriptomics integration for cellular heterogeneity assessment

These pipelines should be implemented with appropriate quality control measures and careful attention to batch effects.

What statistical approaches are recommended for correlating CNIH4 expression with patient outcomes?

Based on published research methodologies, these statistical approaches are recommended:

  • Univariate Survival Analysis:

    • Kaplan-Meier method with log-rank test for survival differences between high and low CNIH4 expression groups

    • Cox proportional hazards model for hazard ratio estimation

    • Analysis of multiple outcomes (OS, DSS, PFI, DFI) for comprehensive evaluation

  • Multivariate Analysis:

    • Cox proportional hazards model including clinicopathological factors

    • Evaluation of CNIH4 as an independent prognostic factor

    • Forest plot visualization of hazard ratios for clear interpretation

  • Cut-point Determination:

    • Data-driven approach using the survminer package to determine optimal expression thresholds

    • Sensitivity analyses with multiple cut-points to ensure robustness

    • Quartile-based stratification for dose-response relationship assessment

  • Non-linear Effects Modeling:

    • Restricted cubic spline (RCS) method to capture complex relationships between CNIH4 expression and risk

    • Martingale residuals plotting to identify appropriate transformation of continuous variables

    • Time-dependent coefficient modeling if proportional hazards assumption is violated

  • Predictive Model Development:

    • Integration of CNIH4 with other biomarkers in composite scoring systems

    • Development of nomograms for individualized risk prediction

    • Performance evaluation through concordance index (C-index) and calibration plots

  • Validation Strategies:

    • Internal validation through bootstrapping or cross-validation

    • External validation in independent cohorts when available

    • Subgroup analyses based on clinicopathological characteristics

These statistical approaches should be implemented with attention to assumptions, potential confounders, and appropriate reporting of effect sizes and confidence intervals.

What are the most promising avenues for translational research on CNIH4?

Based on current evidence, these translational research directions show particular promise:

  • Therapeutic Development:

    • Design of small molecule inhibitors specifically targeting CNIH4-mediated trafficking

    • Development of siRNA-based therapeutics for localized delivery in glioma

    • Exploration of combination approaches targeting CNIH4 and the PI3K-Akt pathway

  • Precision Medicine Applications:

    • Implementation and validation of the CNIH4-based four-gene signature for patient stratification

    • Integration of CNIH4 expression in predictive models for immunotherapy response

    • Development of companion diagnostics for CNIH4-targeted therapies

  • Resistance Mechanisms:

    • Investigation of CNIH4's role in chemotherapy resistance

    • Evaluation of CNIH4 as a mediator of acquired resistance to targeted therapies

    • Exploration of combination approaches to overcome CNIH4-mediated resistance

  • Early Detection:

    • Assessment of CNIH4 as part of multi-marker panels for early cancer detection

    • Evaluation of CNIH4 in liquid biopsy applications (circulating tumor cells, exosomes)

    • Development of sensitive assays for detecting CNIH4 alterations in minimally invasive samples

  • Cancer Stem Cell Targeting:

    • Further characterization of CNIH4's role in cancer stem cell maintenance

    • Development of strategies to target CNIH4-positive cancer stem cells

    • Evaluation of CNIH4 inhibition to enhance conventional therapies through stem cell targeting

These directions leverage CNIH4's established roles in cancer biology while addressing unmet clinical needs in diagnosis, prognosis, and treatment.

What technical advances would significantly enhance CNIH4 research?

Technological developments in these areas would substantially advance CNIH4 research:

  • Structural Biology:

    • Determination of CNIH4 crystal structure for rational drug design

    • Cryo-EM studies of CNIH4-COPII complex to understand trafficking mechanisms

    • Protein-protein interaction mapping through hydrogen-deuterium exchange mass spectrometry

  • Advanced Imaging:

    • Live-cell imaging of CNIH4-mediated trafficking using fluorescent tagging

    • Super-resolution microscopy to visualize CNIH4 subcellular localization

    • Correlative light and electron microscopy to study CNIH4 in vesicular structures

  • Single-Cell Technologies:

    • Single-cell RNA-seq to characterize CNIH4 expression heterogeneity

    • Single-cell proteomics to correlate CNIH4 protein levels with cellular phenotypes

    • Spatial transcriptomics to map CNIH4 expression within the tumor microenvironment

  • Organoid Models:

    • Patient-derived organoid systems for personalized CNIH4 functional studies

    • Brain organoids for studying CNIH4 in glioma in physiologically relevant contexts

    • Co-culture systems integrating immune components to study CNIH4-immune interactions

  • In vivo Monitoring:

    • Development of CNIH4 reporter systems for longitudinal in vivo imaging

    • Multiplexed in vivo imaging to simultaneously track CNIH4 and downstream effectors

    • Circulating biomarker assays to monitor CNIH4-related pathways during treatment

These technological advances would provide deeper mechanistic insights and accelerate translational applications of CNIH4 research findings.

How might CNIH4 research intersect with emerging trends in cancer biology?

CNIH4 research aligns with several cutting-edge areas in cancer biology:

  • Tumor Microenvironment Interactions:

    • CNIH4's relationship with immune cell infiltration suggests potential roles in tumor-immune crosstalk

    • Investigation of CNIH4 in cancer-associated fibroblast interactions

    • Exploration of CNIH4 in extracellular vesicle-mediated communication

  • Therapy Resistance Mechanisms:

    • CNIH4's association with stemness and cell cycle pathways positions it as a potential mediator of therapy resistance

    • Studies linking CNIH4 to acquired resistance mechanisms in targeted therapy

    • Exploration of CNIH4-mediated adaptive responses to treatment stress

  • Metabolic Reprogramming:

    • Investigation of CNIH4's potential role in trafficking of metabolic transporters

    • Examination of connections between CNIH4, PI3K-Akt signaling, and cancer metabolism

    • Exploration of metabolic vulnerabilities in CNIH4-high versus CNIH4-low tumors

  • Tumor Evolution and Heterogeneity:

    • Single-cell analyses to understand CNIH4's contribution to intratumoral heterogeneity

    • Longitudinal studies tracking CNIH4 expression changes during tumor progression

    • Spatial mapping of CNIH4 expression patterns within tumor architecture

  • Systems Biology Approaches:

    • Network analysis integrating CNIH4 into broader cancer signaling networks

    • Multi-omics data integration to position CNIH4 within cancer hallmark pathways

    • Mathematical modeling of CNIH4-dependent trafficking dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.