Recombinant Human Protein cTAGE-2 (CTAGE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CTAGE1; CTAGE2; cTAGE family member 2; Protein cTAGE-2; Cancer/testis antigen 21.2; CT21.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CTAGE1
Target Protein Sequence
MRPDSHPYGFPWELVIRAAVAGFFAVLFLWRSFRSVTSRLYVRREKKFAVALSGLIEEKC KLLEKFSLVQKEYEGYEVESSLKNASFEKEATEAQSLEATCEKLNRFNSELVHEILCLEK ELKEEKSKHSEQNELMADISKRIQSLEDESKSLKSQVAEAKMTFKRFQANEERLEIEIQD AWKENSELQESQKQLLQEAEVWKEQVSELIKQKRTFEDSKVHAEQVLNDKENHIKTLTER LLKMKDGVAMLEEDVTDDDNLELEMNSESEDGAYLDNPPKGALKKLIHAAKLNASLKTLE GERNQIYIQLSEVDKTKEELTEHIKNLQTEQASLQSENTHFESENQKLQQKLKVMTELYQ ENEMKLYRKLIVEEKCRLEKEEKLSKVDEMISHATEELETYRKRAKDLKEFEKTIHFYQK KIILHEKKAHDNWSAAWTAERNLNDLRKENAHNRQKLTEIEFKIKLLEKDPYGLDVPNTA FGRQHSPYGPSPLGWPSSETRASLYPPTLLEGPLRLSPLLPRGGGRGSRGPGNPPDHQIT KERGESSCDRLTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNC ARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLPAENEATGPGF VPPPLAPIRGLLFPVDTRGPFIRRGPPFPPPPPGTVFGASPDYFSPRDVPGPPRAPFAMR NVYLPRGFLPYRPPRPAFFPPAPTF
Uniprot No.

Target Background

Gene References Into Functions
  1. SYCP1, cTAGE1, and GTSF1 are expressed in cutaneous T-cell lymphoma but not in normal skin or benign inflammatory dermatoses. PMID: 24850846
  2. Loss of TSC2 in the brain correlates with reduced survival and abnormal behavior. PMID: 22752306
  3. cTAGE-1 and cTAGE-5 are novel cancer germline antigens. Tumor-specific splicing of cTAGE genes may yield additional candidate proteins suitable for targeted immunotherapy in cutaneous T-cell lymphoma and other malignancies. PMID: 12839582
Database Links

HGNC: 24346

OMIM: 608856

KEGG: hsa:64693

UniGene: Hs.406709

Protein Families
CTAGE family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Testis. Not found in tumor.

Q&A

What is CTAGE1 and what experimental methods confirm its classification as a cancer testis antigen?

CTAGE1, also known as cTAGE-2 or Cancer/testis antigen 21.2 (CT21.2), belongs to the cTAGE family of proteins . It is classified as a cancer testis (CT) antigen, which represents a group of proteins normally expressed exclusively in testicular germ cells but found ectopically expressed in various cancer types . The experimental validation of CTAGE1 as a CT antigen has been primarily established through multiple complementary approaches. RT-PCR analyses conducted across normal tissue panels have demonstrated its restricted expression pattern in testicular tissue under normal physiological conditions . In pathological contexts, serological screening using the SEREX (serological identification of recombinantly expressed genes) approach has confirmed its immunogenicity in CTCL patients, with 11-71% of patient sera showing reactivity against CTAGE1, while control sera typically demonstrate no reactivity . This immunological profile further supports its classification as a cancer testis antigen with potential diagnostic and therapeutic implications.

What are the recommended experimental techniques for detecting CTAGE1 expression in research settings?

Multiple complementary experimental approaches are recommended for robust detection of CTAGE1 expression in research settings:

  • RNA-level detection: RT-PCR remains the gold standard for initial screening of CTAGE1 expression, as demonstrated in studies across CTCL patient cohorts . This method provides high sensitivity for detecting even low-level expression.

  • Protein-level confirmation: Western blot analysis using validated antibodies against CTAGE1 should be employed to confirm translation of the transcript into protein . It's worth noting that HDAC inhibitor studies have revealed cases where mRNA upregulation does not necessarily correlate with increased protein expression, highlighting the importance of protein-level validation .

  • Functional validation: For recombinant CTAGE1 protein, activity can be confirmed through ELISA and Western blot applications .

  • Immunohistochemistry: For tissue-based studies, especially in patient samples, IHC can provide valuable information about cellular and subcellular localization patterns.

When designing experiments, researchers should consider that CTAGE1 expression in cancer specimens demonstrates heterogeneity, necessitating adequate sample sizes and appropriate controls for meaningful interpretation of results .

How does CTAGE1 expression differ between normal tissues and cancer specimens?

CTAGE1 demonstrates a highly restricted expression pattern in normal tissues, with expression primarily limited to testicular germ cells, conforming to the classical definition of a cancer testis antigen . This restricted expression is maintained through epigenetic silencing mechanisms in normal somatic cells.

In contrast, research on CTCL has revealed substantial differences in expression patterns:

  • Normal skin vs. CTCL lesional skin: Studies examining CT antigen expression in 60 CTCL patients demonstrated that cTAGE1 showed the most robust and uniform expression among all tested CT antigens in CTCL patients, while being absent in normal skin samples .

  • Benign inflammatory dermatoses vs. CTCL: CTAGE1 expression was specifically detected in CTCL but not in benign inflammatory dermatoses, highlighting its potential utility as a diagnostic marker for differentiating malignant from benign skin conditions .

  • CTCL cell lines: CTAGE1 demonstrated robust expression at both mRNA and protein levels across a panel of 11 patient-derived CTCL cell lines .

This ectopic expression in cancer cells is thought to result from aberrant epigenetic regulation, as evidenced by the dramatic upregulation of CTAGE1 expression following treatment with HDAC inhibitors in experimental models .

What experimental evidence supports the role of epigenetic regulation in CTAGE1 expression?

Substantial experimental evidence supports the critical role of epigenetic regulation in controlling CTAGE1 expression:

  • HDAC inhibitor studies: Treatment of CTCL cell lines (Hut78, H9, and Mac2A) with the HDAC inhibitors Romidepsin and Vorinostat (SAHA) demonstrated a dramatic, dose-dependent upregulation of CTAGE1 mRNA expression . This effect was observed within 24 hours of treatment, suggesting direct epigenetic regulation rather than secondary effects.

  • Cell line-specific responses: Different CTCL cell lines showed variable magnitude of response to HDAC inhibition, with Hut78 and H9 showing pronounced upregulation while Mac2A cells demonstrated only modest increases in CTAGE1 expression . This heterogeneity suggests that additional regulatory factors beyond histone acetylation may influence CTAGE1 expression in different cellular contexts.

  • mRNA vs. protein expression: Interestingly, while HDAC inhibition strongly increased CTAGE1 mRNA levels, corresponding increases at the protein level were not consistently observed . This discrepancy highlights the complexity of CTAGE1 regulation and suggests that post-transcriptional mechanisms may also play important roles in controlling CTAGE1 protein expression.

These findings have significant methodological implications for researchers studying CTAGE1, as they demonstrate that experimental manipulations of the epigenome can dramatically alter CTAGE1 expression patterns, potentially confounding results if not properly controlled.

What methodological considerations are important when designing experiments to study CTAGE1 in cancer models?

When designing experiments to study CTAGE1 in cancer models, researchers should consider several methodological factors:

  • Expression heterogeneity: Studies across CTCL patients have demonstrated that while CTAGE1 shows more consistent expression than other CT antigens, there remains significant heterogeneity across patients and cell lines . This necessitates adequate sample sizes and appropriate statistical approaches when evaluating CTAGE1 expression patterns.

  • Transcriptional vs. translational analysis: The documented discrepancy between CTAGE1 mRNA and protein levels following HDAC inhibitor treatment highlights the importance of assessing both transcriptional and translational expression . Researchers should employ complementary techniques like RT-PCR and Western blotting rather than relying solely on either approach.

  • Impact of experimental manipulations: Common experimental treatments, particularly HDAC inhibitors (Romidepsin and Vorinostat), can dramatically alter CTAGE1 expression . Researchers using these compounds for other experimental purposes should be aware of their potential impact on CTAGE1 expression.

  • Control selection: Given that CTAGE1 expression is absent in normal skin but present in CTCL, careful selection of appropriate controls is critical . Studies should include normal skin controls, benign inflammatory dermatoses (for specificity), and positive controls (testicular tissue or known CTAGE1-expressing cell lines).

  • p53 status consideration: Experimental data has indicated that mutated p53 status did not appear to be a requirement for the ectopic expression of CT antigens, including CTAGE1 . This suggests that CTAGE1 expression may be regulated through p53-independent mechanisms, an important consideration when selecting cell models with different p53 statuses.

How does CTAGE1 compare to other cancer testis antigens in terms of expression patterns in CTCL?

Comparative analysis of CT antigen expression in CTCL reveals distinct patterns that distinguish CTAGE1 from other cancer testis antigens:

CT AntigenExpression Frequency in CTCLExpression in Cell LinesResponse to HDAC Inhibitors
cTAGE1Robust and uniform in all patientsExpressed in all tested CTCL linesDramatic upregulation
SYCP1Heterogeneous, subset of patientsRobust in majority of cell linesDramatic upregulation
SYCP3Strong expression in <10% of patientsVariable across cell linesVariable response
REC8Heterogeneous, subset of patientsVariable expressionUpregulated
GTSF1Heterogeneous, subset of patientsRobust in majority of cell linesNot fully characterized
SPO11Very limited (3/60 patients)Low baseline expressionDramatically increased after HDAC inhibition

This comparative analysis demonstrates that cTAGE1 exhibits the most consistent expression pattern among CT antigens in CTCL patients, making it potentially the most reliable biomarker candidate from this family . While other CT antigens like SYCP1 and GTSF1 show robust expression in cell lines, their expression in patient samples is more heterogeneous . The universal response of these CT antigens to HDAC inhibition supports a common epigenetic regulatory mechanism, though the magnitude of response varies significantly across different CT antigens and cell lines .

What is the significance of CTAGE1's immunogenicity in CTCL patients and how might this inform therapeutic approaches?

CTAGE1's documented immunogenicity in CTCL patients has significant implications for potential therapeutic approaches:

  • Serological detection: SEREX (serological identification of recombinantly expressed genes) screening has demonstrated that 11-71% of CTCL patient sera react with CTAGE1, while control sera typically show no reactivity . This indicates that CTAGE1 naturally elicits humoral immune responses in a substantial proportion of patients.

  • CTCL-specific expression pattern: The robust expression of CTAGE1 in CTCL lesional skin, combined with its absence in normal skin and benign inflammatory dermatoses, provides a cancer-specific target with potentially limited off-target effects .

  • Potential therapeutic strategies:

    a. T-cell based immunotherapy: Given its immunogenicity and restricted expression pattern, CTAGE1 represents a potential target for adoptive T-cell therapy or cancer vaccines.

    b. Epigenetic modulation: The dramatic upregulation of CTAGE1 following HDAC inhibitor treatment suggests that combining epigenetic modifiers with immunotherapy approaches could enhance target expression and potentially improve therapeutic efficacy .

    c. Biomarker utility: Beyond direct targeting, CTAGE1 expression might serve as a biomarker for patient stratification in clinical trials or for monitoring response to therapy.

  • Methodological considerations for therapeutic development:

    a. Expression heterogeneity: While CTAGE1 shows more consistent expression than other CT antigens in CTCL, the variable expression across patients necessitates consideration of patient selection strategies.

    b. Combination approaches: The synergistic potential of combining HDAC inhibitors (which can upregulate CTAGE1) with immunotherapeutic approaches warrants investigation.

These findings suggest that CTAGE1 could serve as a promising target for CTCL immunotherapy development, with its restricted expression pattern and documented immunogenicity providing a rational basis for therapeutic exploration.

What are the current limitations in our understanding of CTAGE1 function and what experimental approaches might address these gaps?

Despite advances in characterizing CTAGE1 expression patterns, significant knowledge gaps remain regarding its functional roles:

  • Limited functional characterization: While CTAGE1 expression patterns in normal and malignant tissues have been documented, its biological functions in both testicular germ cells and cancer cells remain poorly understood. RNA interference or CRISPR-based knockout studies in CTCL cell lines could help elucidate its role in cancer cell survival, proliferation, or migration.

  • Regulatory network: The mechanisms controlling CTAGE1 expression beyond histone acetylation remain unclear. ChIP-seq studies examining the CTAGE1 promoter region could identify key transcription factors and regulatory elements.

  • Protein interactions: The protein interaction partners of CTAGE1 have not been well characterized. Approaches such as co-immunoprecipitation followed by mass spectrometry or yeast two-hybrid screening could identify interacting proteins and provide insights into its functional pathways.

  • Structural information: Detailed structural studies of CTAGE1 protein would enhance our understanding of its function and potentially facilitate structure-based drug design. X-ray crystallography or cryo-electron microscopy of recombinant CTAGE1 could address this gap.

  • Clinical correlations: The relationship between CTAGE1 expression levels and clinical parameters such as disease progression, treatment response, and patient survival in CTCL remains to be fully characterized. Retrospective analysis of CTAGE1 expression in patient cohorts with long-term follow-up data could address this limitation.

Experimental approaches to address these gaps might include:

  • Multi-omics integration: Combining transcriptomic, proteomic, and epigenomic analyses in models where CTAGE1 expression is modulated could provide comprehensive insights into its functional networks.

  • Single-cell analysis: Given the heterogeneity of CTAGE1 expression, single-cell RNA-seq could reveal whether expression is uniform across all malignant cells or restricted to specific subpopulations with distinct phenotypic properties.

  • in vivo models: Development of animal models with conditional CTAGE1 expression could help elucidate its role in cancer initiation, progression, and response to therapy in an intact organism.

Addressing these knowledge gaps would significantly enhance our understanding of CTAGE1's biological significance and potentially reveal novel therapeutic approaches targeting this cancer testis antigen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.