Recombinant Human Protein Dos (DOS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CBARP; C19orf26; Voltage-dependent calcium channel beta subunit-associated regulatory protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CBARP
Target Protein Sequence
MATAATTTTTTTATVALTTSWDNATGRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGV LLLCKRCWDVHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTS STGRRVSFNEAALFEQSRKTQDKGRQGGWQSTAAGASGMGGGRALMARCCRRYTLTEGDF HHLKNARLTHLHLPPLKIVTIHECDSGEASSATTPHPATSPKATLAIFQPPGKALTGRSV GPSSALPGDPYNSAAGATDFAEISPSASSDSGEGTSLDAGTRSTKAGGPGAAAGPGEAGP GSGAGTVLQFLTRLRRHASLDGASPYFKVKKWKLEPSQRAASLDTRGSPKRHHFQRQRAA SESTEQEEGDAPQEDFIQYIARAGDAVAFPHPRPFLASPPPALGRLEAAEAAGGASPDSP PERGAGSAGPEQQQPPLEPDAERDAGPEQAQTSYRDLWSLRASLELHAAASDHSSSGNDR DSVRSGDSSGSGSGGAAPAFPPPSPPAPRPKDGEARRLLQMDSGYASIEGRGAGDDTEPP AAPARPRSPRAWPRRPRRDYSIDEKTDALFHEFLRHDPHFDDTPAAARHRARAHPHARKQ WQRGRQHSDPGARAAPALAGTPAPPAGAARPARAPLRRGDSVDGPPDGRTLGGAGDDPAI PVIEEEPGGGGCPGSGLCVLPSGSVLDKLAAGLDERLFPPRLAEPVVATPALVAAAPTSP DHSPA
Uniprot No.

Target Background

Function
Negatively regulates voltage-gated calcium channels by inhibiting the interaction between their alpha and beta subunits. This action reduces calcium channel activity at the plasma membrane and indirectly suppresses calcium-regulated exocytosis.
Database Links

HGNC: 28617

KEGG: hsa:255057

STRING: 9606.ENSP00000215376

UniGene: Hs.346575

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type III membrane protein. Cell membrane; Single-pass type III membrane protein. Cell projection, growth cone.

Q&A

What is Design of Experiments (DoE) and why is it beneficial for recombinant protein expression?

The DoE approach involves systematically applying statistics to determine how combinations of input parameters or "factors" set at different "levels" (e.g., culture temperatures of 20°C, 25°C, 30°C) affect an output or "response" (such as recombinant protein yield) . For instance, a study exploring three factors set at three levels required only 13 experimental combinations out of a possible 27 to identify optimal relationships between temperature, pH, and dissolved oxygen concentration on recombinant protein yield .

What are the key factors that influence recombinant human protein expression?

Several critical factors affect recombinant protein production:

  • Host system selection: Different expression systems (E. coli, yeast, mammalian cells) offer varying advantages for different proteins

  • Vector design: Including appropriate promoters, selection markers, and fusion tags

  • Culture conditions: Temperature, pH, dissolved oxygen content, and media composition

  • Induction parameters: Timing, concentration, and duration of induction

  • Post-translational modifications: Requirements for proper protein folding and function

The influence of these factors varies significantly depending on the specific protein. For example, human D-Amino Acid Oxidase requires consideration of its FAD-binding domain and substrate-binding domain when designing expression systems .

How do I determine if my recombinant protein is better expressed in inclusion bodies or in soluble form?

This depends on your downstream applications and protein characteristics:

Methodology for determination:

  • Conduct parallel small-scale expression tests varying temperature (15-37°C), induction strength, and host strains

  • Analyze protein fractions by SDS-PAGE and Western blotting

  • Measure functional activity where possible

  • Consider solubility prediction tools based on primary sequence

The main disadvantage of inclusion body expression is the high operational cost for recovery in a soluble form, while the advantage is often higher protein yield . For example, one study achieved 250 mg/L of soluble functional recombinant pneumolysin (rPly) in E. coli through DoE optimization instead of inclusion body recovery .

How should I structure a DoE approach for optimizing recombinant protein production?

A structured DoE approach involves these key steps:

  • Define objective, factors, and ranges :

    • Establish clear objectives (screening, optimization, or robustness testing)

    • Select relevant factors (pH, temperature, media components)

    • Determine appropriate factor ranges

  • Define responses and measurement systems :

    • Identify quantitative measurements (protein yield, purity, activity)

    • Ensure measurement systems have suitable precision and accuracy

  • Create the experimental design:

    • Select appropriate design type (factorial, response surface)

    • Determine necessary number of experiments

    • Plan for replication and randomization

  • Execute experiments and analyze data:

    • Use statistical software (MiniTab®, Modde®, Design-Expert®) to generate models

    • Validate predictions with confirmation experiments

This process becomes iterative, with each round of DoE providing information for improved designs in subsequent rounds .

What statistical design is most appropriate for optimizing recombinant protein expression?

The choice of statistical design depends on your research phase:

  • Screening phase: Fractional factorial designs help identify significant factors from many variables with relatively few experiments. This is useful when initially evaluating 5+ potential factors.

  • Optimization phase: Response Surface Methodology (RSM) designs such as Central Composite or Box-Behnken are appropriate when modeling non-linear relationships between 2-5 key factors and protein yield.

  • Robustness testing: Plackett-Burman designs help evaluate how small variations in process parameters affect consistency of protein production.

For example, a multivariant design approach was shown to be superior to traditional univariant methods in characterizing recombinant protein expression as it enables the estimation of experimental error, comparison of effects between normalized variables, and gathering high-quality information with fewer experiments .

How many experimental replicates are necessary for a statistically robust DoE in protein expression studies?

For a statistically robust DoE in recombinant protein expression:

  • Minimum replication: At least three biological replicates for each experimental condition

  • Center point replication: 3-5 replicates of center point conditions to estimate pure error

  • Error calculation: Replication allows calculation of experimental error and determination of whether lack of fit is statistically significant

The number of replicates may need to increase when:

  • Process variability is high

  • Small effects need to be detected

  • Greater confidence in results is required

Most DoE software packages can calculate the required number of replicates based on desired statistical power and expected variability.

How can I integrate multiple quality attributes in a DoE approach for recombinant protein optimization?

To integrate multiple quality attributes:

  • Define Quality Target Product Profile (QTPP) with specifications for:

    • Protein yield

    • Purity levels

    • Biological activity

    • Physicochemical properties

  • Implement multivariate optimization using desirability functions:

    • Assign weights to different quality attributes based on importance

    • Create composite desirability score that balances all attributes

    • Use response surface methodologies to find optimal operating space

  • Develop Analytical Hierarchy Process (AHP):

    • Structure decision hierarchy for quality attributes

    • Perform pairwise comparisons between attributes

    • Calculate priority vectors for optimal decision-making

For example, one study demonstrated that the quality of spinal fusion achieved with recombinant human bone morphogenetic protein-2 did not significantly change across a 40-fold range of doses (58-920 μg), suggesting that above a threshold dose, quality outcomes are not dose-dependent .

What are the best approaches for evaluating the stability and activity of recombinant proteins during DoE optimization?

Comprehensive evaluation requires multiple analytical techniques:

  • Stability assessment methods:

    • Differential Scanning Calorimetry (DSC) to determine thermal stability

    • Size Exclusion Chromatography (SEC) to monitor aggregation

    • Circular Dichroism (CD) spectroscopy for secondary structure changes

    • Accelerated stability studies at various temperatures

  • Activity assessment approaches:

    • Enzyme kinetics (Km, Vmax, kcat) measurements

    • Cell-based functional assays

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

For example, recombinant Human D-Amino Acid Oxidase activity can be measured using a fluorescence-based assay with D-alanine as substrate and hydrogen peroxide production as the measurable output :

Specific Activity (pmol/min/μg) = Adjusted Fluorescence (RFU) × Conversion Factor (pmol/RFU) / [Incubation time (min) × amount of enzyme (μg)]

How can I optimize recombinant protein expression for proteins that require complex post-translational modifications?

For proteins requiring complex post-translational modifications:

  • Select appropriate expression system:

    • Mammalian cell lines (HEK293, CHO) for most human-like glycosylation patterns

    • Insect cells for intermediate complexity modifications

    • Engineered yeast systems for specific glycosylation patterns

  • Apply DoE to optimization parameters:

    • Culture media supplements (glycosylation precursors)

    • Temperature shifts during production phase

    • Feeding strategies for glycosylation components

    • pH profiles throughout culture duration

  • Monitor glycosylation profiles:

    • Mass spectrometry to characterize glycan structures

    • Lectin microarrays for glycan pattern analysis

    • Capillary electrophoresis for charge variant profiles

Studies show that HEK293S cell lines with gene deletions halting N-glycan processing at intermediate stages can produce proteins with uniform N-glycans consisting of 2 N-acetylglucosamine residues plus five mannose residues (Man5GlcNAc2), allowing for controlled glycosylation profiles .

What statistical analyses should be applied to DoE data for recombinant protein production?

Comprehensive statistical analysis should include:

  • Basic statistical measures:

    • Analysis of variance (ANOVA) to determine significant factors

    • Regression analysis to develop predictive models

    • Residual analysis to validate model assumptions

  • Advanced statistical techniques:

    • Response surface methodology (RSM) for optimization

    • Partial least squares (PLS) for multivariate analysis

    • Principal component analysis (PCA) for data reduction

  • Model validation approaches:

    • Cross-validation techniques

    • Confirmation runs at predicted optimal conditions

    • Calculation of prediction intervals for responses

These analyses help identify critical process parameters (CPPs) that significantly impact critical quality attributes (CQAs) of the recombinant protein.

How can I address protein expression failures in DoE studies?

When addressing protein expression failures:

  • Systematic troubleshooting approach:

    • Verify gene sequence and plasmid integrity

    • Check for rare codons and optimize if necessary

    • Evaluate toxicity of the expressed protein

    • Assess mRNA stability and translation efficiency

  • Advanced predictive models:

    • Analysis of mRNA secondary structure around start codons

    • Accessibility of translation initiation sites

Research indicates that approximately 50% of recombinant proteins fail to express in various host cells. A study analyzing 11,430 recombinant protein production experiments found that the accessibility of translation initiation sites modeled using mRNA base-unpairing across Boltzmann's ensemble significantly outperformed alternative features in predicting expression success .

  • Iterative DoE approaches:

    • Redefine factor ranges based on previous results

    • Implement alternative expression strategies

    • Consider fusion protein approaches to improve solubility

What metrics should be used to evaluate the success of a DoE approach in recombinant protein production?

Comprehensive evaluation metrics include:

  • Statistical model quality indicators:

    • R² (coefficient of determination)

    • Adjusted R² (accounts for model complexity)

    • Q² (predictive power from cross-validation)

    • Model validity and reproducibility

  • Process performance metrics:

    • Fold-improvement in protein yield

    • Reduction in batch-to-batch variability

    • Time and resource savings compared to OFAT approach

    • ROI (Return on Investment) of the DoE implementation

  • Quality improvement indicators:

    • Enhanced protein purity

    • Improved biological activity

    • Better stability profiles

    • Reduced impurity levels

A successful DoE implementation should provide not only improved yields but also enhanced process understanding that contributes to future protein expression projects.

How can machine learning be integrated with DoE for recombinant protein optimization?

Machine learning integration with DoE offers several advantages:

  • Enhanced experimental design:

    • Adaptive experimental designs that update based on real-time data

    • Active learning algorithms to select most informative next experiments

    • Transfer learning from similar proteins to predict optimal conditions

  • Advanced data analysis:

    • Neural networks for complex non-linear relationships modeling

    • Random forests for feature importance ranking

    • Support vector machines for classification of successful vs. failed expressions

  • Implementation approaches:

    • Hybrid models combining mechanistic understanding with data-driven insights

    • Automated laboratory systems with integrated ML algorithms

    • Bayesian optimization frameworks for sequential experimentation

For example, analyzing data from 12,634 affinity-purified antibodies generated against human recombinant protein fragments showed that propensity scales could predict antibody response with a Pearson correlation coefficient of 0.25, providing a basis for machine learning models to further improve predictive power .

What novel DoE approaches are emerging for multi-parameter optimization of difficult-to-express recombinant proteins?

Cutting-edge approaches include:

  • Genetic algorithm-guided DoE:

    • Evolutionary algorithms that mimic natural selection

    • Iterative optimization across large parameter spaces

    • Parallel evaluation of multiple solutions

  • Miniaturized high-throughput DoE platforms:

    • Microfluidic systems for nanoliter-scale experiments

    • Automated microbioreactor arrays

    • Multiplexed analytical methods for rapid response measurement

  • Space-filling designs for complex parameter spaces:

    • Optimal Latin Hypercube designs

    • Uniform Design methodology

    • D-optimal designs for irregular experimental regions

These advanced approaches allow exploration of larger design spaces with fewer resources, making comprehensive optimization of difficult-to-express proteins more feasible.

How can DoE be applied to optimize cell-free protein synthesis systems for recombinant human proteins?

DoE optimization for cell-free protein synthesis involves:

  • Key factor optimization:

    • Energy regeneration system components

    • Translation machinery concentration

    • Ion concentrations (Mg²⁺, K⁺)

    • Template design and concentration

  • System-specific considerations:

    • Extract preparation methods

    • Reaction format (batch vs. continuous-exchange)

    • Supplementation strategies for cofactors and chaperones

    • Redox environment optimization

  • Readout systems for rapid optimization:

    • Real-time fluorescent protein synthesis monitoring

    • Online NMR for metabolite tracking

    • Continuous sampling for kinetic modeling

Cell-free systems offer advantages for toxic or membrane proteins and allow direct access to the reaction environment for real-time manipulation and analysis during DoE studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.