Recombinant Human Protein FAM134A (FAM134A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it for preferential development.
Synonyms
RETREG2; C2orf17; FAM134A; MAG2; Reticulophagy regulator 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
RETREG2
Target Protein Sequence
MASGGGGGNTGAGGGPGMGLSLGLGLGLSLGMSEATSEAEEEAATAEAVGRLATTLWLRL RGWEAVLAAAQRLLVWEKPLHSLVTAAALNGLFWLLSSSSLRPFFLLSVSLLAYFLLDLW QPRFLPDVSASSPEEPHSDSEGAGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKR QNPAQFCVRVCSGCAVLAVLGHYVPGIMISYIVLLSILLWPLVVYHELIQRMYTRLEPLL MQLDYSMKAEANALHHKHDKRKRQGKNAPPGGDEPLAETESESEAELAGFSPVVDVKKTA LALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEETLSRDLGEG EEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPD GVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPAPSPSILPPVPQDSPQPLPA PEEEEALTTEDFELLDQGELEQLNAELGLEPETPPKPPDAPPLGPDIHSLVQSDQEAQAV AEP
Uniprot No.

Target Background

Gene References Into Functions
  1. Depletion of the endoplasmic reticulum-localized protein FAM134A impairs mitotic progression by affecting metaphase plate alignment and pressure generation through cortical myosin II delocalization. PMID: 29097687
  2. MAG-2 may be a novel causal gene contributing to lung cancer invasion and metastasis. PMID: 19212629
Database Links

HGNC: 28450

KEGG: hsa:79137

STRING: 9606.ENSP00000395249

UniGene: Hs.516707

Protein Families
RETREG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of FAM134A and how does it compare to other FAM134 family members?

FAM134A is an ER-resident protein characterized by a reticulon homology domain (RHD) and a LC3-interacting region (LIR) motif. The RHD consists of two ER-anchoring transmembrane helical hairpins (TM1,2 and TM3,4) connected by a flexible cytoplasmic linker and two amphipathic helices (AH L and AH C) that interact with the cytoplasmic leaflet . Despite only about 30% homology between FAM134 family members, the LIR motif and flanking amino acids are highly conserved across all three proteins (FAM134A, FAM134B, FAM134C) and across species .

Notably, molecular dynamics simulations reveal that FAM134A-RHD demonstrates a more rigid structure with small fluctuations around the average conformation (98.08% in a single dominant cluster), while FAM134B and FAM134C show greater conformational flexibility with multiple distinct conformational states .

What is the subcellular localization of FAM134A?

Immunofluorescence microscopy of U2OS cells expressing HA-tagged FAM134A demonstrates that the protein is present throughout the endoplasmic reticulum network, as evidenced by overlap with ER markers CALNEXIN (CANX) and REEP5 . This diffuse ER localization pattern differs from the more fragmented ER pattern observed upon FAM134B overexpression .

What is FAM134A's primary function in cellular homeostasis?

FAM134A functions as an ER-phagy receptor involved in maintaining ER morphology and protein homeostasis. Unlike FAM134B, which induces dramatic ER fragmentation under basal conditions, FAM134A exhibits limited ability to fragment ER under normal conditions but can be activated during environmental stresses like nutrient starvation . FAM134A participates in the quality control of specific ER proteins, including misfolded Collagen I, through a pathway that appears to be independent of FAM134B .

What cellular and animal models are available for studying FAM134A function?

Several experimental models are available for FAM134A research:

  • Cell lines: Studies utilize U2OS cells with inducible or stable expression of FAM134A constructs .

  • Knockout models: Fam134a knockout mouse embryonic fibroblasts (MEFs) have been generated and are available for research . These Fam134a−/− MEFs allow for loss-of-function studies and reconstitution experiments.

  • Knockout mice: Fam134a single knockout mice have been generated, enabling tissue-specific and whole-organism studies of FAM134A function .

What methods can be used to monitor FAM134A-mediated ER-phagy?

ER-phagy mediated by FAM134A can be monitored using several approaches:

  • Fluorescent reporter systems: The ssRFP-GFP-KDEL reporter system allows for monitoring ER-phagy flux through changes in the ratio of RFP/GFP fluorescence intensity. This dual-color reporter system exploits the differential pH sensitivity of RFP and GFP, with GFP fluorescence quenched in the acidic environment of lysosomes while RFP remains stable .

  • Live cell imaging: The IncuCyte S3 system can be used to monitor fluorescence of GFP and RFP, as well as cell confluence over time in 384-well format .

  • Biochemical assays: Pull-down experiments with purified GST-mATG8s can be used to assess FAM134A's interaction with autophagy proteins .

  • Microscopy: Immunofluorescence microscopy using HA-tagged FAM134A constructs can visualize ER fragmentation and colocalization with LC3B-positive structures under various conditions .

How does FAM134A interact with the autophagy machinery?

FAM134A contains a functional LIR motif that mediates binding to ATG8 family proteins. Pull-down experiments with purified GST-mATG8s demonstrate that FAM134A can bind to all six mATG8 proteins to varying degrees . This interaction is abolished by mutation of the LIR motif in FAM134A or by mutation of the classical binding site on LC3B, confirming the presence of a canonical LIR motif .

What stimuli activate FAM134A-mediated ER-phagy?

While FAM134A shows limited ability to fragment the ER under basal conditions, several stimuli can activate its ER-phagy function:

  • Nutrient starvation: Treatment with EBSS (Earle's Balanced Salt Solution) significantly increases the number of ER fragments in cells overexpressing FAM134A .

  • mTOR inhibition: Treatment with Torin1, an mTOR inhibitor, can induce FAM134A-mediated ER-phagy .

  • ER stress: Though not explicitly stated in the provided materials, ER stress may also activate FAM134A, as it is known to induce ER-phagy through other receptors.

What post-translational modifications regulate FAM134A activity?

While the provided search results don't specifically detail post-translational modifications of FAM134A, related family member FAM134C is regulated by CK2-mediated phosphorylation during starvation-induced ER-phagy . This suggests that similar regulatory mechanisms might exist for FAM134A, though further research is needed to confirm specific post-translational modifications and their functional consequences.

How does FAM134A function differ from FAM134B and FAM134C?

Despite structural similarities, the three FAM134 proteins exhibit distinct functional characteristics:

  • Basal ER-phagy activity: FAM134B overexpression induces dramatic ER fragmentation under basal conditions, whereas FAM134A maintains a uniform distribution over the ER network with few LC3B-positive ER fragments. FAM134C exhibits an intermediate phenotype .

  • Response to starvation: Upon nutrient starvation, all three proteins can induce ER fragmentation, though to different degrees .

  • Collagen quality control: FAM134A drives a FAM134B- and LIR-independent degradation pathway for misfolded Collagen I. Overexpression of FAM134A, but not FAM134C, can rescue pro-Collagen-I accumulation in Fam134b knockout MEFs .

  • Tissue distribution: The three Fam134 proteins show a broad but heterogeneous distribution across organs and tissues, suggesting tissue-specific roles for each paralogue .

Is there functional redundancy between FAM134A and other FAM134 family members?

There appears to be both redundancy and specificity in FAM134 family functions:

  • Independent essential roles: All three FAM134 proteins are individually essential for maintaining ER morphology and protein homeostasis .

  • Partial functional compensation: FAM134A can compensate for some functions of FAM134B, as evidenced by its ability to rescue pro-Collagen-I accumulation in Fam134b knockout cells, even with a mutated LIR domain (FAM134A∆LIR) .

  • Distinct pathways: FAM134A appears to operate through a pathway that is independent of FAM134B, while FAM134C seems to act in concert with FAM134B in the degradation of misfolded Collagen I .

How can structural modeling and molecular dynamics simulations enhance our understanding of FAM134A function?

Structural modeling and molecular dynamics simulations provide valuable insights into FAM134A's mechanism of action:

  • Conformational dynamics: Coarse-grained molecular dynamics (CGMD) simulations reveal that FAM134A-RHD adopts a more rigid structure compared to FAM134B and FAM134C, with a narrow distribution of the radius of gyration and a single dominant conformational cluster (98.08%) .

  • Membrane interactions: Simulations can predict how the amphipathic helices and transmembrane domains of FAM134A interact with and potentially remodel ER membranes .

  • Structure-function relationships: Modeling helps identify key structural elements that may explain functional differences between FAM134 family members, such as why FAM134A shows less ability to fragment ER under basal conditions compared to FAM134B .

For researchers interested in this approach, computational methods include:

  • Using AlignME to score hydrophobicity patterns and generate pair-wise alignments

  • Using Modeller to build 3D structures

  • Performing coarse-grained molecular dynamics using the MARTINI force field

  • Analyzing radius of gyration, clustering conformations, and measuring root mean square fluctuations (RMSF)

What are the implications of FAM134A dysfunction in disease contexts?

While the provided materials don't explicitly discuss FAM134A in disease contexts, research on related family member FAM134B indicates potential disease relevance:

  • Cancer: FAM134B has been described in the context of esophageal and colorectal cancers , suggesting that FAM134A may also have roles in cancer biology worth investigating.

  • Neuropathies: FAM134B is implicated in the pathogenesis of hereditary sensory and autonomic neuropathy (HSANII) . Given the role of all FAM134 proteins in ER homeostasis, FAM134A dysfunction might similarly contribute to neurological disorders.

  • ER stress-related diseases: As FAM134A is essential for ER morphology and protein homeostasis, its dysfunction could potentially contribute to diseases characterized by ER stress and proteostasis imbalance.

What are key considerations for FAM134A overexpression studies?

When designing overexpression studies with FAM134A, researchers should consider:

  • Expression system: U2OS TRex stable and inducible cell lines can be generated by cloning FAM134A cDNAs into MSCV iTAP N-FLAG-HA retroviral vector .

  • Tagging strategy: HA-tagging of FAM134A allows for immunofluorescence detection without significantly affecting protein function .

  • Expression level control: Doxycycline-inducible systems (1 μg/ml) enable controlled expression of FAM134A to avoid potential artifacts from excessive overexpression .

  • Appropriate controls: Include both wild-type and LIR-mutant (∆LIR) versions of FAM134A to distinguish between LIR-dependent and LIR-independent functions .

How can researchers effectively reconstitute FAM134A function in knockout models?

For reconstitution experiments in Fam134a knockout cells:

  • Vector selection: The pBABE retroviral vector with appropriate resistance markers (e.g., hygromycin) can be used for stable reconstitution .

  • Virus production: Retroviruses for FAM134A reconstitution can be generated in HEK293T cells by co-transfecting the retroviral vector containing FAM134A cDNA with packaging plasmid (viral Gag-Pol) and envelope plasmid (VSV-G) .

  • Selection conditions: For reconstituted MEFs, culture media can be supplemented with appropriate antibiotics (e.g., 100 μg/ml hygromycin) to maintain stable expression .

  • Functional validation: Reconstitution should be validated by assessing ER morphology, protein interactions, and ER-phagy flux using established assays .

What are the key unresolved questions regarding FAM134A function?

Several important questions about FAM134A remain to be fully addressed:

  • Substrate specificity: What determines which ER components or misfolded proteins are targeted by FAM134A versus other ER-phagy receptors?

  • Regulatory mechanisms: What post-translational modifications and protein interactions regulate FAM134A activity in response to different cellular stresses?

  • Physiological roles: What are the tissue-specific functions of FAM134A in vivo, and how do they differ from other FAM134 family members?

  • Pathological implications: Is FAM134A dysfunction associated with specific human diseases, and could it be a therapeutic target?

What novel methodologies could advance FAM134A research?

Emerging techniques that could drive advances in FAM134A research include:

  • Proximity labeling: BioID or APEX2-based proximity labeling could identify the FAM134A interactome under different conditions.

  • Super-resolution microscopy: Techniques like STORM or PALM could provide detailed visualization of FAM134A-mediated ER membrane remodeling.

  • Cryo-electron microscopy: Structural analysis of FAM134A and its complexes could reveal key mechanistic insights into its function.

  • CRISPR-based screens: Genome-wide or targeted screens could identify novel regulators and effectors of FAM134A-mediated processes.

  • Tissue-specific conditional knockout models: These could help elucidate the physiological relevance of FAM134A in different organ systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.