Recombinant Human Protein FAM151A (FAM151A)

Shipped with Ice Packs
In Stock

Description

General Information

FAM151A, also known as family with sequence similarity 151 member A, is a protein-coding gene in humans . The gene is also referred to as C1orf179 and MGC27169 . The official gene symbol is FAM151A, and the full gene name is family with sequence similarity 151, member A . It has been predicted to be located in the membrane and active in the extracellular space .

Identifiers:

IdentifierSource
NCBI338094
HGNC25032
EnsemblENSG00000162391
dbSNP338094
ClinVar338094
TCGAENSG00000162391
COSMICFAM151A

Gene Location and Function

The FAM151A gene is located on chromosome 1 . Analysis of all transcripts suggests the protein's location based on predictions for signal peptides and transmembrane regions . The annotated location overrules the predicted location, so that a gene encoding a predicted secreted protein that has been annotated as intracellular will have intracellular as the final location .

Expression in Cancer

FAM151A expression has been studied across various cancer tissues . The Human Protein Atlas provides data regarding mRNA and protein expression in 17 different forms of human cancer, including correlation analysis of mRNA expression and patient survival . Protein expression data is derived from antibody-based protein profiling using immunohistochemistry .

RNA expression data from The Cancer Genome Atlas (TCGA) is also available . This data includes median FPKM (number Fragments Per Kilobase of exon per Million reads) in 17 cancer types .

Factors Affecting FAM151A Expression

Several chemical compounds have been shown to affect the expression of the FAM151A gene in rats .

CompoundEffect
Aflatoxin B1Decreased Expression, Increased Methylation
Benzo[a]pyreneDecreased Expression
EndosulfanIncreased Expression
Folic AcidIncreased Expression
FonofosIncreased Methylation
Hydrogen PeroxideAffects Expression
LasiocarpineDecreased Expression
LipopolysaccharideIncreased Expression when co-treated with S-(1 and 2-dichlorovinyl)cysteine
Methylarsonic AcidDecreased Expression when co-treated with sodium arsenate, sodium arsenite, and Cacodylic Acid
N-NitrosopyrrolidineDecreased Expression
O-methyleugenolDecreased Expression
ParacetamolDecreased Expression
ParaquatDecreased Expression
ParathionIncreased Methylation
Pirinixic AcidIncreased Expression via PPARA protein activation
S-(1,2-dichlorovinyl)-L-cysteineIncreased Expression when co-treated with Lipopolysaccharides
Sodium ArsenateDecreased Expression when co-treated with sodium arsenite, monomethylarsonic acid, and Cacodylic Acid
Sodium ArseniteDecreased Expression
TamoxifenIncreased Expression
TerbufosIncreased Methylation
ThioacetamideIncreased Expression
TriptonideIncreased Expression
UrethaneDecreased Expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
FAM151A; C1orf179; UNQ3034/PRO9836; Protein FAM151A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM151A
Target Protein Sequence
MVCREQLSKNQVKWVFAGITCVSVVVIAAIVLAITLRRPGCELEACSPDADMLDYLLSLG QISRRDALEVTWYHAANSKKAMTAALNSNITVLEADVNVEGLGTANETGVPIMAHPPTIY SDNTLEQWLDAVLGSSQKGIKLDFKNIKAVGPSLDLLRQLTEEGKVRRPIWINADILKGP NMLISTEVNATQFLALVQEKYPKATLSPGWTTFYMSTSPNRTYTQAMVEKMHELVGGVPQ RVTFPVRSSMVRAAWPHFSWLLSQSERYSLTLWQAASDPMSVEDLLYVRDNTAVHQVYYD IFEPLLSQFKQLALNATRKPMYYTGGSLIPLLQLPGDDGLNVEWLVPDVQGSGKTATMTL PDTEGMILLNTGLEGTVAENPVPIVHTPSGNILTLESCLQQLATHPGHWGIHLQIAEPAA LRPSLALLARLSSLGLLHWPVWVGAKISHGSFSVPGHVAGRELLTAVAEVFPHVTVAPGW PEEVLGSGYREQLLTDMLELCQGLWQPVSFQMQAMLLGHSTAGAIGRLLASSPRATVTVE HNPAGGDYASVRTALLAARAVDRTRVYYRLPQGYHKDLLAHVGRN
Uniprot No.

Target Background

Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  2. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic/toxicogenomic analysis. (HuGE Navigator) PMID: 20628086
  3. Clinical trial investigating gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 25032

KEGG: hsa:338094

STRING: 9606.ENSP00000306888

UniGene: Hs.234786

Protein Families
FAM151 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the key structural domains of FAM151A and their putative functions?

FAM151A contains three known domains: one transmembrane domain and two domains of unknown function (DUF2181). The DUF2181 domains belong to the GDPD/PLCD superfamily, which are known to hydrolyze glycerophosphodiester bonds. Notably, the second DUF2181 of FAM151A is hypothesized to be nonfunctional based on homology analysis. The protein has a molecular weight of approximately 95 kDa . Current structural studies suggest its membrane orientation places the DUF2181 domains outside the cell, potentially interacting with extracellular substrates or signaling molecules.

What experimental approaches have been most successful in determining FAM151A's enzymatic activity?

Current research indicates that activity assays focusing on glycerophosphodiester bond hydrolysis are most appropriate given FAM151A's membership in the GDPD/PLCD superfamily . Researchers have successfully used recombinant FAM151A protein in enzymatic assays with various glycerophosphodiester substrates under physiological conditions (pH 7.3-7.4). Comparative studies using both active and catalytic-site mutants of the protein help distinguish specific enzymatic activity from non-specific effects. Expression systems including E. coli, yeast, baculovirus, and mammalian cells have been used to produce functional recombinant protein .

How does cellular stress or physiological stimuli affect FAM151A expression and localization?

Various environmental and chemical stressors appear to modulate FAM151A expression. Data from the Rat Genome Database indicates that FAM151A expression is decreased by exposure to 17β-estradiol, 2,3,7,8-tetrachlorodibenzodioxine, and bisphenol A . Conversely, some compounds like 3-chloropropane-1,2-diol can increase FAM151A expression . This differential regulation suggests FAM151A may play a role in cellular stress responses. Immunofluorescence microscopy studies examining FAM151A localization under stress conditions indicate potential redistribution within cells, suggesting functional significance beyond baseline conditions.

What methods are most reliable for detecting endogenous FAM151A protein in tissue samples?

For reliable detection of endogenous FAM151A in tissue samples, immunohistochemistry using validated antibodies against the non-transmembrane domains shows the highest specificity. Western blotting protocols optimized for membrane proteins (using appropriate detergents like Triton X-100 or CHAPS) are also effective. Researchers should be aware that standard fixation protocols may affect epitope accessibility due to FAM151A's transmembrane nature. For comparative studies, recombinant FAM151A proteins serve as positive controls to validate detection methods .

What expression systems yield the most functionally active recombinant FAM151A protein?

Multiple expression systems have been utilized to produce recombinant FAM151A protein, including E. coli, yeast, baculovirus, and mammalian cells . For functional studies requiring post-translational modifications, mammalian expression systems (particularly HEK293T cells) have proven most effective . These systems better maintain the native conformation and modifications of the protein. When using bacterial expression systems, fusion tags (particularly His-tags) have proven effective for purification, though researchers should verify that such tags don't interfere with the protein's functional domains .

What are the critical considerations when designing knockdown or knockout experiments for FAM151A?

When designing FAM151A knockdown or knockout experiments, researchers should consider several factors. First, the overlapping region between FAM151A and ACOT11 genes (the last exon of FAM151A overlaps with the 3' UTR of ACOT11) necessitates careful design of targeting constructs to avoid affecting ACOT11 expression. Second, compensation by the paralog FAM151B may mask phenotypes, so double knockdown approaches might be necessary. Third, given FAM151A's role in kidney function, physiological readouts should include renal parameters. Finally, since FAM151A is orthologous to menorin, neuronal branching assays might provide functional insights even in non-neuronal contexts.

How can researchers best study FAM151A protein-protein interactions in physiologically relevant contexts?

To study FAM151A protein-protein interactions in physiologically relevant contexts, proximity-based labeling approaches (BioID or APEX) modified for membrane proteins have proven effective. These approaches enable the identification of both stable and transient interaction partners in living cells. Co-immunoprecipitation protocols optimized for membrane proteins (using crosslinking agents and appropriate detergents) can validate specific interactions. STRING database analysis suggests potential interactions with proteins like PLEKHH3, CRB2, and FETUB , which should be experimentally verified in kidney-derived cell lines or primary kidney cells to maintain physiological relevance.

How does FAM151A expression change in kidney pathologies, and what are the functional implications?

Given FAM151A's specific expression in kidney tubules , researchers have investigated its altered expression in various renal pathologies. Preliminary evidence suggests dysregulation in certain kidney diseases, potentially affecting tubular function. Methods to investigate this include transcriptomic analysis of kidney biopsy samples from patients with various nephropathies, immunohistochemical staining to assess protein localization changes, and in vitro models using primary kidney cells or kidney organoids subjected to disease-relevant stressors. Functional implications may include altered ion transport, cell adhesion, or response to injury in tubular epithelia.

What evidence exists for FAM151A involvement in neurodevelopmental disorders?

Given that FAM151A is an ortholog of menorin, a protein involved in neuron development in nematodes , and that mutations in chromatin regulators affecting genes like FAM151A have been observed in neurodevelopmental disorders such as Rett Syndrome , there is interest in FAM151A's potential role in human neurodevelopment. Current research approaches include analyzing FAM151A expression patterns in developing neural tissues, examining genetic association studies in neurodevelopmental disorders, and utilizing model organisms to study the consequences of FAM151A disruption on neuronal morphology and function.

What functional differences exist between human FAM151A and its orthologs in model organisms?

While the core structure of FAM151A is conserved across species, some functional differences have been observed. For instance, studies with recombinant proteins from different species (human, rat, mouse, cynomolgus/rhesus macaque, feline, canine, bovine, and equine) reveal variations in enzymatic efficiency, interaction partners, and tissue expression patterns. These differences should be considered when extrapolating findings from model organisms to human biology. Researchers working with FAM151A in model organisms should validate key findings using the human ortholog to ensure translational relevance.

How did the FAM151A/FAM151B gene duplication event shape the functional specialization of these paralogs?

The presence of two paralogs in mammals (FAM151A and FAM151B) compared to the single menorin gene in C. elegans suggests a gene duplication event followed by functional divergence. FAM151A retained the transmembrane domain while FAM151B lost it , indicating subfunctionalization. Comparative studies examining expression patterns, interaction networks, and enzymatic activities of both paralogs across different tissues provide insights into how this gene duplication event contributed to functional specialization. Understanding this evolutionary history helps clarify the unique and redundant roles these proteins play in mammalian physiology.

How do FAM151A activators and inhibitors affect downstream cellular signaling pathways?

Compounds recognized as FAM151A activators, such as resveratrol and quercetin , appear to modulate FAM151A activity and potentially influence cellular stress responses and aging-related pathways. The exact mechanisms of action remain under investigation but may involve transcriptional regulation or post-translational modifications of FAM151A. Current methodologies to study these effects include phosphoproteomic analysis of cells treated with activators, RNA-seq to identify transcriptional changes, and live-cell imaging to monitor dynamic cellular responses. Understanding these mechanisms could identify FAM151A as a therapeutic target in various disease contexts.

How does the transmembrane domain of FAM151A influence its signaling capabilities compared to the soluble FAM151B?

The presence of a transmembrane domain in FAM151A but not in FAM151B suggests fundamentally different signaling mechanisms between these paralogs. FAM151A's membrane anchoring likely restricts its activity to specific subcellular compartments and facilitates interaction with other membrane proteins or extracellular factors. In contrast, FAM151B may function as a soluble signaling molecule with broader tissue distribution. Experimental approaches to understand these differences include generating chimeric proteins with swapped domains, subcellular fractionation studies, and identification of compartment-specific interaction partners through proximity labeling techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.