Recombinant Human Protein FAM162A (FAM162A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM162A; C3orf28; E2IG5; DC16; FWP001; Protein FAM162A; E2-induced gene 5 protein; Growth and transformation-dependent protein; HGTD-P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPL HKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVI EGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE
Uniprot No.

Target Background

Function

FAM162A is proposed to regulate apoptosis, although the precise mechanism may vary across cell types and tissues. It may participate in hypoxia-induced cell death in transformed cells, potentially involving cytochrome C release, caspase activation (such as CASP9), and mitochondrial permeability transition. In neuronal cells, it may contribute to hypoxia-induced cell death by promoting the release of AIFM1 from mitochondria to the cytoplasm and its subsequent nuclear translocation. However, the involvement of caspases in this process remains a subject of ongoing investigation.

Gene References Into Functions
  1. Expression and clinicopathological significance of human growth and transformation-dependent protein (HGTD-P) in uterine cervical cancer. PMID: 20840676
  2. HGTD-P is identified as a novel hypoxia-inducible factor 1 alpha-responsive proapoptotic molecule that activates mitochondrial apoptotic cascades. PMID: 15082785
  3. Heat shock protein 90 interacts physically with HGTD-P. PMID: 16698020
  4. HGTD-P expression is prevalent during the progression from normal gastric mucosa to intestinal-type carcinoma and may correlate with tumor cell proliferation. PMID: 19269009
  5. HGTD-P exhibits a proapoptotic function in the developing rat brain after hypoxia-ischemia by activating caspase 3 and inducing apoptosis-inducing factor (AIF) nuclear translocation. PMID: 19520982
Database Links

HGNC: 17865

OMIM: 608017

KEGG: hsa:26355

STRING: 9606.ENSP00000419088

UniGene: Hs.584881

Protein Families
UPF0389 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is FAM162A and where is it localized in cells?

FAM162A (also known as HGTD-P) is a mitochondrial protein first identified in 2004 as a target of the transcription factor HIF-1α, and it is highly conserved among evolutionarily distant taxa and ubiquitously expressed in many tissues . At the organismal level, FAM162A mRNA displays higher expression in colon, esophagus, heart, kidney, and liver tissues . While FAM162A was initially proposed to contain two transmembrane segments based on protein deletion studies, more recent localization studies have revealed that it resides predominantly in the inner mitochondrial membrane, particularly within the cristae . Experimental methods including protease protection assays in COS7 cells have confirmed this localization, resolving previous controversies about its precise subcellular position . This localization within the cristae is functionally significant, as it allows FAM162A to modulate the fusion protein OPA1, influencing mitochondrial dynamics .

How evolutionarily conserved is FAM162A across species?

FAM162A demonstrates remarkable evolutionary conservation across different taxonomic groups, indicating its fundamental importance in cellular biology . Blast analysis shows that FAM162A is widely expressed among different taxa, with gene and protein homology ranging from 99% in monkeys to 50% in fish when compared to humans . The 3D protein structure modeled through AlphaFold 2.0 software reveals two transmembrane segments, an extended loop with a short alpha-helix domain, and a C-terminus alpha-helix structure . This high degree of conservation across species suggests that FAM162A plays a crucial and fundamental role in cellular physiology, particularly in mitochondrial function . The conservation pattern also makes FAM162A an excellent candidate for comparative studies across model organisms, as demonstrated by successful functional experiments in both mammalian cells and Drosophila models .

What is the relationship between FAM162A and mitochondrial bioenergetics?

FAM162A plays a critical role in maintaining proper mitochondrial bioenergetics, as evidenced by loss-of-function experiments in COS7 cells . When FAM162A is knocked down, cells exhibit a significant 50% reduction in mitochondrial membrane potential, as evaluated by TMRE staining in non-quenching mode and live cell microscopy . Additionally, these cells show a 20% reduction in basal respiration, 30% reduction in maximal respiration, and 45% reduction in spare capacity respiration as determined by Seahorse analysis . Interestingly, these bioenergetic deficiencies occur without significant changes in the expression levels of OXPHOS proteins, suggesting that FAM162A influences mitochondrial function through other mechanisms, potentially related to cristae structure and organization . Conversely, FAM162A overexpression increases bioenergetic capacity, promoting a metabolic switch from glycolysis to OXPHOS metabolism, which enhances cellular resistance to oxidative stress .

What methods are commonly used to study FAM162A localization?

Researchers employ several complementary approaches to study FAM162A localization within mitochondria . The protease protection assay is a primary method, where constructs expressing FAM162A fused to GFP at either the N-terminus (FAM-N-GFP) or C-terminus (FAM-C-GFP) are created and transfected into cells like COS7 . As controls, researchers utilize cells co-transfected with Omp25_mCherry and pmMitoTurquoise (MitoTQ) plasmids to label both the intermembrane space and the mitochondrial matrix respectively . Fluorescence microscopy is then used to track the localization and protection of the GFP tags following protease treatment . Additionally, immunoblotting techniques with appropriate antibodies can verify the expression and localization of FAM162A, while electron microscopy provides ultrastructural evidence of its position within the inner mitochondrial membrane and cristae .

How does FAM162A influence mitochondrial morphology and dynamics?

FAM162A plays a crucial role in maintaining mitochondrial morphology and promoting fusion dynamics, primarily through its influence on OPA1 expression and function . Qualitative analysis of mitochondrial morphology from TMRE-stained confocal images reveals that FAM162A knockdown causes a significant shift in mitochondrial distribution patterns - specifically, an increase in puncta mitochondria from 21% to 34% and a decrease in network mitochondria from 26% to 9% compared to control cells . At the ultrastructural level, mitochondria from FAM162A-silenced cells are significantly smaller in terms of area and perimeter, and display increased circularity, indicating fragmentation . Notably, FAM162A knockdown leads to a significant 50% reduction in OPA1 protein levels without affecting other mitochondrial dynamics proteins including MFN1, MFN2, DRP1, phosphorylated DRP1 (Ser616), and FIS1 . This selective influence on OPA1, a key mediator of inner membrane fusion and cristae structure, aligns with FAM162A's localization in the inner mitochondrial membrane and explains the observed fragmentation phenotype .

How can transgenic Drosophila models be used to study FAM162A function at the organismal level?

Transgenic Drosophila models offer a powerful system for investigating FAM162A's function at the organismal level, particularly regarding lifespan and stress resistance . To generate such models, human FAM162A cDNA (Gene ID: 26355) is optimized for Drosophila melanogaster codons and cloned into an appropriate vector like pUASTattB-5xUAS/Mini_Hsp70 . This UAS-hFAM162A construct is then inserted into the Drosophila genome to create UAS_FAM162A transgenic flies, enabling targeted expression using the UAS/GAL4 system . For ubiquitous expression, UAS_FAM162A flies are crossed with Tubulin-GAL4 flies to generate UAS/GAL4_FAM162A_OE flies . Lifespan analysis can be conducted by housing 20 flies of each genotype and sex in culture tubes with ad-libitum food at specific temperatures (e.g., 29°C), monitoring survival daily until natural death . Additionally, heat stress resistance can be assessed by subjecting groups of flies to elevated temperatures (e.g., 40°C) and recording survival and locomotor activity . Such models have revealed that FAM162A overexpression extends lifespan by approximately 25% under normal conditions and 40% under heat stress, with more pronounced effects in females .

What experimental approaches are used to assess FAM162A's impact on mitochondrial function?

Researchers employ multiple complementary techniques to comprehensively evaluate FAM162A's impact on mitochondrial function . For bioenergetic assessment, Seahorse technology provides detailed measurements of oxygen consumption rate, enabling quantification of basal respiration, maximal respiration, and spare respiratory capacity in cells with modulated FAM162A expression . Mitochondrial membrane potential is evaluated using fluorescent probes like TMRE in non-quenching mode, coupled with live-cell confocal microscopy . Cell viability can be assessed using MTT assays, while cell mortality is measured through LDH release assays . To examine mitochondrial morphology, confocal microscopy of fluorescently labeled mitochondria allows classification of mitochondrial units into categories such as puncta, large/round, rod (unbranched), and network (branched) structures . Ultrastructural analysis via electron microscopy provides detailed insights into mitochondrial size, perimeter, circularity, and structural abnormalities like bubble-like swollen mitochondria . Additionally, immunoblotting for key mitochondrial proteins (OXPHOS components, dynamics regulators like OPA1) helps connect morphological observations to molecular mechanisms .

How should I design loss-of-function experiments to study FAM162A?

Designing effective loss-of-function experiments for FAM162A requires careful consideration of knockdown methodology, appropriate controls, and comprehensive phenotypic assessment . For RNA interference approaches, multiple shRNA constructs targeting different regions of FAM162A mRNA should be tested to ensure specificity and effectiveness; successful studies have utilized pLVCTH-shFAM162A constructs with multiple shRNA sequences (e.g., #2, #4, and #5) alongside empty vector controls . Transfection efficiency and knockdown levels must be confirmed by immunoblot 48 hours post-transfection before proceeding with functional assays . A multi-parameter assessment approach is essential, including cell viability (MTT assay), cell mortality (LDH assay), mitochondrial membrane potential (TMRE staining), respiratory capacity (Seahorse analysis), and mitochondrial morphology (confocal microscopy) . Additionally, electron microscopy provides crucial insights into ultrastructural changes, while immunoblotting for mitochondrial dynamics proteins (particularly OPA1, MFN1, MFN2, DRP1, and FIS1) helps elucidate the molecular mechanisms underlying observed phenotypes . This comprehensive approach enables researchers to connect FAM162A deficiency to specific cellular and mitochondrial outcomes.

What are the key considerations when expressing recombinant FAM162A in experimental systems?

Successfully expressing recombinant FAM162A in experimental systems requires attention to several critical factors across different model systems . For cellular studies, constructs should be designed with appropriate tags (e.g., GFP) at either the N-terminus or C-terminus to facilitate localization studies and functional analyses without disrupting protein targeting or function . When creating transgenic organisms like Drosophila, the human FAM162A cDNA should be codon-optimized for the host species to ensure efficient translation, and appropriate expression systems (such as the UAS/GAL4 system in Drosophila) should be employed for controlled expression . Expression verification is essential through methods like immunoblotting, comparing to both positive controls (e.g., transfected mammalian cells) and negative controls (e.g., non-transgenic organisms) . For functional studies, both gain-of-function (overexpression) and loss-of-function (knockdown) approaches provide complementary insights, ideally tested across multiple cell types or tissues to account for context-dependent effects . Additionally, researchers should consider the paradoxical roles of FAM162A in apoptosis versus cell survival when interpreting phenotypic outcomes across different experimental conditions .

How can I study the interaction between FAM162A and OPA1?

Investigating the interaction between FAM162A and OPA1 requires a multi-faceted approach combining protein interaction studies, functional analyses, and localization experiments . Co-immunoprecipitation assays using antibodies against either FAM162A or OPA1 can determine whether these proteins physically interact, while proximity ligation assays or fluorescence resonance energy transfer (FRET) can assess their close association within intact cells . Examining the effects of FAM162A manipulation on OPA1 processing is crucial, as FAM162A knockdown has been shown to reduce OPA1 levels by approximately 50% . Researchers should analyze both long and short OPA1 isoforms by immunoblotting following FAM162A silencing or overexpression . Co-localization studies using confocal microscopy with fluorescently tagged proteins can confirm that FAM162A and OPA1 share similar distribution patterns within the inner mitochondrial membrane and cristae . Functional studies should assess whether the mitochondrial fragmentation and cristae abnormalities observed in FAM162A-deficient cells can be rescued by OPA1 overexpression, which would establish a functional link between these proteins in maintaining mitochondrial morphology and dynamics .

What is the potential significance of FAM162A in age-related diseases and longevity?

FAM162A shows promising significance in age-related diseases and longevity based on its critical role in maintaining mitochondrial health and its demonstrated effects on organismal lifespan . Transgenic Drosophila overexpressing human FAM162A exhibited a remarkable 25% increase in lifespan under normal conditions and a 40% increase under heat stress conditions, with female flies showing a more pronounced benefit (approximately 12.5% longer lifespan than males) . This lifespan extension correlates with FAM162A's function in preserving mitochondrial ultrastructure, promoting fusion dynamics through OPA1, and enhancing bioenergetic capacity . Given that mitochondrial dysfunction is a hallmark of aging and age-related diseases, FAM162A's protective effects on mitochondrial integrity position it as a potential therapeutic target . Furthermore, FAM162A's demonstrated ability to enhance stress resistance suggests it may contribute to cellular resilience mechanisms that decline with age, potentially offering insights into interventions that promote healthy aging or address mitochondrial dysfunction in conditions like neurodegenerative diseases, cardiovascular disorders, and metabolic syndromes .

How might the role of FAM162A in cancer be therapeutically exploited?

The paradoxical roles of FAM162A in cancer present both challenges and opportunities for therapeutic exploitation . While initially characterized as a pro-apoptotic protein under hypoxic conditions, FAM162A is overexpressed in several cancer types where it appears to promote proliferation and migration rather than cell death . This duality suggests context-dependent functions that require careful targeting strategies . Potential therapeutic approaches could focus on either inhibiting FAM162A in cancers where it promotes tumor growth or enhancing its pro-apoptotic function specifically in cancer cells . Understanding the molecular mechanisms that switch FAM162A from pro-survival to pro-apoptotic functions could reveal intervention points, possibly related to oxygen tension, mitochondrial dynamics, or interaction partners like VDAC or OPA1 . Given FAM162A's critical role in mitochondrial bioenergetics, combination approaches targeting both FAM162A and metabolic vulnerabilities in cancer cells might prove effective . Additionally, the relationship between FAM162A and mitochondrial dynamics through OPA1 could be exploited, as disrupted mitochondrial fusion/fission balance is increasingly recognized as important in cancer progression and therapeutic response .

What are the knowledge gaps in understanding FAM162A function?

Despite significant advances in characterizing FAM162A, several important knowledge gaps remain that warrant further investigation . The molecular mechanism by which FAM162A influences OPA1 levels and function is still not fully understood - whether through direct protein-protein interaction, influence on OPA1 processing, or indirect effects via other mitochondrial components . The switches that determine FAM162A's seemingly contradictory roles in promoting either apoptosis or cell survival remain largely uncharacterized and likely involve complex interactions with the cellular microenvironment, metabolic state, and stress conditions . While FAM162A's presence in the inner mitochondrial membrane has been established, its precise distribution across different mitochondrial subdomains (boundary membrane vs. cristae) and potential dynamic redistribution under different cellular conditions require further exploration . Additionally, the potential roles of post-translational modifications in regulating FAM162A function remain virtually unexplored but could be crucial for understanding its context-dependent effects . Finally, while transgenic Drosophila studies have revealed FAM162A's impact on organismal lifespan, the underlying tissue-specific contributions and molecular mechanisms of this life-extending effect require more detailed investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.