Recombinant Human Protein FAM162B (FAM162B)

What is FAM162B and what are its basic structural characteristics?

FAM162B (Family with sequence similarity 162 member B) is a human protein encoded by the FAM162B gene located on chromosome 6q22.1 . The full-length human FAM162B protein consists of 162 amino acids with the sequence: MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEIHRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK .

This protein belongs to the FAM162 family, and its recombinant form can be produced with various tags (such as His-tag) to facilitate purification and detection in experimental settings. When studying FAM162B, researchers should note its molecular weight and physical properties which influence experimental design, particularly regarding protein solubility and stability during purification processes.

What expression systems are commonly used for producing recombinant FAM162B?

E. coli is the most commonly utilized expression system for producing recombinant FAM162B, particularly when fused to an N-terminal His-tag . This bacterial expression system offers several methodological advantages:

• High protein yield with relatively low cost

• Rapid growth and expression kinetics

• Well-established protocols for induction and purification

• Compatibility with various fusion tags

For optimal expression in E. coli systems, consider the following methodological approach:

• Optimize codon usage for bacterial expression

• Test multiple induction conditions (IPTG concentration, temperature, and duration)

• Include protease inhibitors during cell lysis

• Implement a stepwise purification strategy, typically beginning with immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

Alternative expression systems such as mammalian, insect, or yeast cells might be preferable for studies requiring post-translational modifications not produced in bacterial systems.

What are the optimal storage conditions for recombinant FAM162B?

To maintain the stability and activity of recombinant FAM162B, specific storage conditions must be adhered to:

The methodology for optimal storage includes preparing small working aliquots immediately after reconstitution to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity and stability . When planning long-term experiments, researchers should validate protein stability at different time points using activity assays or structural integrity tests.

How should I design experiments to study FAM162B function?

Designing rigorous experiments to study FAM162B function requires careful consideration of variables, controls, and detection methods. Following established experimental design principles:

• Define your variables clearly:

  • Independent variable: The parameter you manipulate (e.g., FAM162B concentration, mutation status)

  • Dependent variable: The measured outcome (e.g., binding affinity, cellular localization)

  • Control variables: Factors held constant across experimental conditions

• Formulate a specific, testable hypothesis:

  • Null hypothesis example: "FAM162B does not influence cellular response to hypoxic conditions"

  • Alternative hypothesis example: "Increased FAM162B expression enhances cellular survival under hypoxic conditions"

• Design appropriate experimental treatments:

  • Include sufficient concentration range for dose-response relationships

  • Establish appropriate time points for temporal studies

  • Incorporate relevant physiological conditions

• Implement proper controls:

  • Negative controls (e.g., buffer only, irrelevant protein)

  • Positive controls (e.g., known interacting proteins)

  • Vehicle controls when using solvents or carriers

  • Mock transfections for expression studies

• Assign experimental units to treatment groups:

  • Use randomization to minimize bias

  • Consider blocked designs for heterogeneous samples

  • Determine appropriate sample sizes through power analysis

For FAM162B specifically, cellular localization studies, interaction screens, and functional assays should be considered as complementary approaches to build a comprehensive understanding of its biological role.

What methodologies are most suitable for studying protein-protein interactions involving FAM162B?

Several complementary methodologies can be employed to characterize protein-protein interactions involving FAM162B:

• In vitro methods:

  • Pull-down assays using His-tagged recombinant FAM162B

  • Surface Plasmon Resonance (SPR) for binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Crosslinking coupled with mass spectrometry

• Cellular methods:

  • Co-immunoprecipitation (Co-IP)

  • Proximity Ligation Assay (PLA)

  • Fluorescence Resonance Energy Transfer (FRET)

  • Bimolecular Fluorescence Complementation (BiFC)

• Genetic approaches:

  • Yeast two-hybrid screening

  • Mammalian two-hybrid systems

  • CRISPR activation or knockout paired with interactome analysis

Each method has distinct advantages and limitations. For rigorous characterization, a minimum of two orthogonal methods should be employed to confirm interactions. When using His-tagged FAM162B for pull-down assays, researchers should be aware that the tag itself might influence binding properties, necessitating control experiments with alternatively tagged or untagged protein versions.

How can I verify the purity and activity of recombinant FAM162B?

Verification of recombinant FAM162B purity and activity involves multiple analytical techniques:

For purity assessment:

• SDS-PAGE analysis with Coomassie staining (expected purity >90%)

• Western blotting using anti-FAM162B or anti-His antibodies

• Size exclusion chromatography (SEC) to detect aggregates or truncations

• Mass spectrometry for precise molecular weight and potential contaminants

For activity verification:

• Circular dichroism (CD) to assess secondary structure integrity

• Thermal shift assays to determine protein stability

• Functional binding assays with known interaction partners

• Cell-based activity assays relevant to the hypothesized function

Quality control parameters should include:

• Endotoxin testing if the protein will be used in cell culture experiments

• Batch-to-batch consistency verification

• Stability assessment under experimental conditions

Documentation of quality control data is essential for reproducible research. Create detailed records of protein lot numbers, purification procedures, and validation results for inclusion in methods sections of publications.

How can CRISPR activation be utilized to study endogenous FAM162B function?

CRISPR activation (CRISPRa) technology offers a powerful approach to study endogenous FAM162B function by upregulating its expression from the native genomic locus. This methodology preserves natural regulatory mechanisms while allowing controlled expression enhancement.

The Synergistic Activation Mediator (SAM) system represents an advanced CRISPRa approach featuring three key components:

• A catalytically dead Cas9 (dCas9) fused to a VP64 activation domain

• A target-specific sgRNA engineered with MS2 binding loops

• An MS2-P65-HSF1 fusion protein that enhances transcriptional activation

For effective implementation of CRISPRa for FAM162B studies:

The CRISPRa system provides several advantages over traditional overexpression methods, including physiologically relevant expression levels and maintenance of normal isoform ratios. This approach is particularly valuable for studying FAM162B in its native cellular context while avoiding artifacts associated with exogenous expression systems .

What approaches can be used to investigate the subcellular localization of FAM162B?

Understanding the subcellular localization of FAM162B provides critical insights into its potential functions. Multiple complementary approaches should be employed:

• Immunofluorescence microscopy:

  • Use validated antibodies against FAM162B or tag epitopes

  • Co-stain with organelle markers (e.g., MitoTracker, ER-Tracker)

  • Apply super-resolution techniques for detailed localization

• Subcellular fractionation:

  • Isolate distinct cellular compartments through differential centrifugation

  • Analyze fractions by Western blot to detect FAM162B

  • Include compartment-specific marker proteins as controls

• Proximity labeling approaches:

  • Express FAM162B fused to BioID or APEX2

  • Identify neighboring proteins through biotinylation

  • Map protein microenvironments within cellular compartments

• Live-cell imaging:

  • Generate fluorescent protein fusions (e.g., FAM162B-GFP)

  • Monitor dynamic localization in response to stimuli

  • Employ FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

Based on amino acid sequence analysis, FAM162B contains potential transmembrane domains (CYIMIGLTIIACFAVIVS), suggesting it may localize to cellular membranes . When designing localization experiments, researchers should consider this predicted topology and incorporate appropriate membrane markers.

How does human FAM162B compare to orthologs in other species for comparative studies?

Comparative studies between human FAM162B and its orthologs provide evolutionary insights and can inform functional hypotheses. The following methodological approach is recommended:

• Sequence alignment analysis:

  • Perform multiple sequence alignments of FAM162B from human, mouse, rhesus macaque, and zebrafish

  • Identify conserved domains and motifs across species

  • Calculate sequence identity and similarity percentages

• Structural comparison:

  • Generate structural predictions using AlphaFold or similar tools

  • Compare predicted folding patterns across species

  • Identify conserved structural elements despite sequence divergence

• Expression pattern analysis:

  • Compare tissue-specific expression profiles across species

  • Analyze developmental expression timing

  • Identify species-specific regulatory elements

• Functional complementation assays:

  • Express orthologs in FAM162B-deficient human cells

  • Assess rescue of phenotypes

  • Identify species-specific functional differences

Resources available for comparative studies include recombinant proteins from multiple species:

• Human FAM162B (full-length, 162 amino acids)

• Mouse FAM162B (His-tagged)

• Rhesus macaque FAM162B (His-Fc-Avi-tagged)

• Danio rerio (zebrafish) FAM162B (His-tagged)

Cross-species functional analyses can reveal evolutionarily conserved roles while highlighting species-specific adaptations, providing a broader context for understanding human FAM162B function.

What are common challenges in expressing and purifying recombinant FAM162B and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant FAM162B. Here are methodological solutions to common problems:

• Low expression yield:

  • Optimize codon usage for the expression system

  • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

  • Adjust induction parameters (temperature reduction to 16-18°C)

  • Consider autoinduction media for gradual protein expression

• Protein insolubility:

  • Express as fusion protein with solubility enhancers (SUMO, MBP, TRX)

  • Include mild detergents in lysis buffer if membrane association is suspected

  • Test expression in different compartments (cytoplasmic vs. periplasmic)

  • Employ refolding protocols if inclusion bodies form

• Protein degradation:

  • Add protease inhibitor cocktails during all purification steps

  • Maintain samples at 4°C throughout purification

  • Minimize purification duration through optimized protocols

  • Add stabilizing agents (glycerol, trehalose) to storage buffers

• Loss of activity after reconstitution:

  • Verify buffer compatibility (avoid oxidizing conditions)

  • Validate proper refolding through structural analysis

  • Include reducing agents if disulfide formation is problematic

  • Test multiple reconstitution protocols varying pH and ionic strength

When working with His-tagged FAM162B, consider that imidazole used for elution can affect protein stability. Dialysis or buffer exchange immediately after elution is recommended, followed by activity validation using functional assays specific to FAM162B.

How can I design controlled experiments to study the functional role of FAM162B?

Designing rigorous controlled experiments for FAM162B functional studies requires:

• System selection based on research questions:

  • In vitro biochemical assays for direct molecular interactions

  • Cell line models expressing endogenous FAM162B

  • Primary cells for physiologically relevant contexts

  • Animal models for in vivo function (if available)

• Manipulation approaches:

  • Gain-of-function: CRISPR activation or overexpression

  • Loss-of-function: siRNA, shRNA, or CRISPR knockout

  • Mutation analysis: Structure-guided point mutations

  • Competitive inhibition: Using peptide fragments or antibodies

• Control design:

  • Between-subjects controls: Parallel samples with manipulated variables

  • Within-subjects controls: Baseline measurements before intervention

  • Negative controls: Non-targeting constructs, irrelevant proteins

  • Positive controls: Known regulators of the pathway being studied

• Experimental validation:

  • Confirm target manipulation (qPCR, Western blot)

  • Use multiple independent methods to test hypotheses

  • Include biological replicates (minimum n=3)

  • Apply appropriate statistical analysis for the experimental design

For studies involving cellular phenotypes, researchers should first characterize baseline FAM162B expression in their model system and choose manipulation approaches that achieve physiologically relevant changes rather than extreme overexpression or complete depletion, which may lead to artifacts.

What analytical methods should be used to assess protein-protein interactions involving FAM162B?

To comprehensively characterize protein-protein interactions involving FAM162B, a multi-method analytical approach is recommended:

• Biophysical characterization:

  • Surface Plasmon Resonance (SPR) for kinetic parameters (kon, koff, KD)

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters (ΔH, ΔS, ΔG)

  • Microscale Thermophoresis (MST) for interactions in solution

  • Analytical Ultracentrifugation (AUC) for complex stoichiometry

• Structural analysis:

  • X-ray crystallography of co-crystallized complexes

  • Cryo-electron microscopy for larger assemblies

  • NMR spectroscopy for dynamic interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for interface mapping

• Computational approaches:

  • Molecular docking simulations

  • Molecular dynamics to assess stability of predicted interactions

  • Network analysis of interactome data

• Functional validation:

  • Mutagenesis of predicted interface residues

  • Competition assays with peptide fragments

  • Cellular co-localization studies

  • Functional readouts of downstream effects

When working with His-tagged FAM162B, researchers should be aware that the tag itself might influence binding properties . Control experiments using alternatively tagged versions or tag-cleaved protein are recommended to verify that observed interactions are not artifacts of the tagging strategy.

How can high-throughput approaches be applied to study FAM162B interactions and functions?

High-throughput methodologies offer powerful approaches to systematically characterize FAM162B:

• Interactome mapping:

  • Proximity-dependent biotin identification (BioID) or APEX2

  • Immunoprecipitation coupled with mass spectrometry (IP-MS)

  • Protein microarrays with recombinant FAM162B probes

  • Yeast two-hybrid screens against tissue-specific libraries

• Functional genomics:

  • CRISPR screens (activation or knockout) in FAM162B-expressing cells

  • Arrayed siRNA libraries targeting potential interactors

  • Pooled shRNA screens with phenotypic selection

  • Synthetic lethality screens to identify functional relationships

• Multi-omics integration:

  • Correlate FAM162B expression with transcriptome profiles

  • Analyze phosphoproteome changes upon FAM162B manipulation

  • Map metabolic alterations in response to FAM162B levels

  • Integrate data using computational network analysis

• Drug discovery applications:

  • Small molecule library screens for FAM162B modulators

  • Peptide phage display to identify binding motifs

  • Fragment-based screening using NMR or thermal shift assays

  • In silico screening against structural models

These high-throughput approaches generate hypotheses that require subsequent validation through targeted experiments. When designing such studies, researchers should include appropriate controls, standardized protocols, and robust statistical analyses to minimize false discoveries while maximizing sensitivity.

What considerations are important when designing experiments comparing FAM162B with its paralog FAM162A?

Comparative studies between FAM162B and its paralog FAM162A require careful experimental design:

• Sequence and structure comparison:

  • Align amino acid sequences to identify shared and unique domains

  • Compare predicted secondary and tertiary structures

  • Analyze evolutionary conservation patterns

  • Identify potential functional motifs unique to each paralog

• Expression analysis:

  • Compare tissue-specific expression patterns

  • Analyze subcellular localization differences

  • Determine co-expression networks

  • Investigate regulation by common or distinct transcription factors

• Functional differentiation:

  • Design rescue experiments (can one paralog compensate for the other?)

  • Compare interaction partners through parallel IP-MS studies

  • Assess phenotypic outcomes of selective depletion

  • Analyze paralog-specific post-translational modifications

• Methodological considerations:

  • Use paralogs as reciprocal controls in experiments

  • Ensure antibody specificity through careful validation

  • Design paralog-specific targeting strategies for CRISPR or RNAi

  • Include both paralogs in functional assays to detect redundancy

When using recombinant proteins, researchers should standardize expression systems, purification methods, and storage conditions to enable direct comparisons . Additionally, considering evolutionary aspects of gene duplication and divergence can provide context for functional differences observed between these paralogs.

How can structural biology approaches advance our understanding of FAM162B?

Structural biology approaches provide crucial insights into FAM162B function:

• Structure determination methods:

  • X-ray crystallography of purified recombinant FAM162B

  • Cryo-electron microscopy for membrane-associated forms

  • NMR spectroscopy for dynamic regions and ligand binding

  • Integrative modeling combining multiple experimental inputs

• Sample preparation strategies:

  • Construct design (full-length vs. domains, tag position)

  • Expression optimization for structural studies

  • Purification protocols that maintain native conformation

  • Stabilization strategies (ligands, antibody fragments, nanobodies)

• Computational approaches:

  • Homology modeling based on similar protein structures

  • Molecular dynamics simulations to probe conformational flexibility

  • AlphaFold or RoseTTAFold predictions

  • Binding site prediction and virtual screening

• Structure-function analysis:

  • Site-directed mutagenesis of key residues identified structurally

  • Design of conformation-specific antibodies

  • Structure-guided development of interaction inhibitors

  • Domain deletion/swapping experiments

The 162-amino acid sequence of FAM162B contains regions predicted to form transmembrane domains, which presents specific challenges for structural studies . For membrane proteins like FAM162B, detergent screening and membrane mimetics (nanodiscs, amphipols) may be necessary to maintain native structure during purification and analysis.